Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4672283..4672799 | Replicon | chromosome |
| Accession | NZ_LR588408 | ||
| Organism | Klebsiella pneumoniae strain NCTC11698 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | FGL30_RS22695 | Protein ID | WP_040240475.1 |
| Coordinates | 4672283..4672567 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | FGL30_RS22700 | Protein ID | WP_002886901.1 |
| Coordinates | 4672557..4672799 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL30_RS22675 | 4667679..4667987 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
| FGL30_RS26415 | 4668072..4668245 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| FGL30_RS22680 | 4668248..4668991 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| FGL30_RS22685 | 4669348..4671486 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| FGL30_RS22690 | 4671815..4672279 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| FGL30_RS22695 | 4672283..4672567 | - | 285 | WP_040240475.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGL30_RS22700 | 4672557..4672799 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FGL30_RS22705 | 4672877..4674787 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| FGL30_RS22710 | 4674810..4675964 | - | 1155 | WP_023159544.1 | lactonase family protein | - |
| FGL30_RS22715 | 4676031..4676771 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11186.00 Da Isoelectric Point: 10.3787
>T288437 WP_040240475.1 NZ_LR588408:c4672567-4672283 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKTAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKTAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|