Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4572339..4573149 | Replicon | chromosome |
Accession | NZ_LR588408 | ||
Organism | Klebsiella pneumoniae strain NCTC11698 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | FGL30_RS22270 | Protein ID | WP_004178461.1 |
Coordinates | 4572339..4572872 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | FGL30_RS22275 | Protein ID | WP_002887278.1 |
Coordinates | 4572883..4573149 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL30_RS22265 | 4571170..4572291 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
FGL30_RS22270 | 4572339..4572872 | - | 534 | WP_004178461.1 | GNAT family N-acetyltransferase | Toxin |
FGL30_RS22275 | 4572883..4573149 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
FGL30_RS22280 | 4573252..4574685 | - | 1434 | WP_040242656.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
FGL30_RS22285 | 4574675..4575358 | - | 684 | WP_038808523.1 | copper response regulator transcription factor CusR | - |
FGL30_RS22290 | 4575530..4576915 | + | 1386 | WP_040242658.1 | efflux transporter outer membrane subunit | - |
FGL30_RS22295 | 4576933..4577277 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T288436 WP_004178461.1 NZ_LR588408:c4572872-4572339 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |