Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3930423..3931042 Replicon chromosome
Accession NZ_LR588408
Organism Klebsiella pneumoniae strain NCTC11698

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag FGL30_RS19170 Protein ID WP_002892050.1
Coordinates 3930824..3931042 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag FGL30_RS19165 Protein ID WP_002892066.1
Coordinates 3930423..3930797 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL30_RS19155 3925575..3926768 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
FGL30_RS19160 3926791..3929937 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
FGL30_RS19165 3930423..3930797 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
FGL30_RS19170 3930824..3931042 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
FGL30_RS19175 3931201..3931767 + 567 WP_002892030.1 maltose O-acetyltransferase -
FGL30_RS26285 3931739..3931879 - 141 WP_004147370.1 hypothetical protein -
FGL30_RS19180 3931900..3932371 + 472 Protein_3737 YlaC family protein -
FGL30_RS19185 3932346..3933797 - 1452 WP_040239981.1 PLP-dependent aminotransferase family protein -
FGL30_RS19190 3933898..3934596 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
FGL30_RS19195 3934593..3934733 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
FGL30_RS19200 3934733..3934996 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T288434 WP_002892050.1 NZ_LR588408:3930824-3931042 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT288434 WP_002892066.1 NZ_LR588408:3930423-3930797 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References