Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1492963..1493625 | Replicon | chromosome |
| Accession | NZ_LR536843 | ||
| Organism | Streptococcus pneumoniae strain GPSC55 substr. ST3774 isolate b04a6400-1f66-11e7-b93e-3c4a9275d6c8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | E0F34_RS08120 | Protein ID | WP_000192221.1 |
| Coordinates | 1493452..1493625 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | E0F34_RS08115 | Protein ID | WP_000961810.1 |
| Coordinates | 1492963..1493415 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0F34_RS08090 | 1488853..1489596 | - | 744 | WP_001188206.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| E0F34_RS08095 | 1489598..1490548 | - | 951 | WP_078170518.1 | 50S ribosomal protein L11 methyltransferase | - |
| E0F34_RS08100 | 1490686..1491114 | - | 429 | WP_061649866.1 | NUDIX hydrolase | - |
| E0F34_RS08105 | 1491095..1492183 | - | 1089 | WP_050966590.1 | M50 family metallopeptidase | - |
| E0F34_RS08110 | 1492202..1492672 | - | 471 | WP_000257097.1 | DUF3013 family protein | - |
| E0F34_RS08115 | 1492963..1493415 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| E0F34_RS08120 | 1493452..1493625 | - | 174 | WP_000192221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| E0F34_RS08125 | 1493768..1494016 | - | 249 | WP_000797237.1 | hypothetical protein | - |
| E0F34_RS08130 | 1494006..1494221 | - | 216 | WP_075329187.1 | hypothetical protein | - |
| E0F34_RS08135 | 1494519..1495790 | + | 1272 | WP_130885242.1 | replication-associated recombination protein A | - |
| E0F34_RS08145 | 1496338..1497657 | - | 1320 | WP_061649864.1 | glycoside hydrolase family 32 protein | - |
| E0F34_RS08150 | 1497667..1498512 | - | 846 | WP_000819519.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6368.47 Da Isoelectric Point: 10.8214
>T288424 WP_000192221.1 NZ_LR536843:c1493625-1493452 [Streptococcus pneumoniae]
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
Download Length: 174 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT288424 WP_000961810.1 NZ_LR536843:c1493415-1492963 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|