Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 28092..28789 | Replicon | genome plasmid 3 |
| Accession | NZ_LR536452 | ||
| Organism | Methylocella tundrae isolate MTUNDRAET4 annotated | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | MTUNDRAET4_RS19415 | Protein ID | WP_134493258.1 |
| Coordinates | 28367..28789 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | MTUNDRAET4_RS19410 | Protein ID | WP_134493256.1 |
| Coordinates | 28092..28370 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTUNDRAET4_RS19395 | 25423..25782 | - | 360 | WP_134493252.1 | hypothetical protein | - |
| MTUNDRAET4_RS19400 | 25779..26807 | - | 1029 | WP_134493505.1 | DUF1612 domain-containing protein | - |
| MTUNDRAET4_RS19405 | 26915..27490 | - | 576 | WP_134493254.1 | Uma2 family endonuclease | - |
| MTUNDRAET4_RS19410 | 28092..28370 | + | 279 | WP_134493256.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MTUNDRAET4_RS19415 | 28367..28789 | + | 423 | WP_134493258.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MTUNDRAET4_RS19420 | 28894..29478 | - | 585 | WP_134493260.1 | hypothetical protein | - |
| MTUNDRAET4_RS19425 | 29468..29764 | - | 297 | WP_134493262.1 | hypothetical protein | - |
| MTUNDRAET4_RS19430 | 30006..31088 | + | 1083 | WP_134493264.1 | site-specific integrase | - |
| MTUNDRAET4_RS19435 | 32411..33628 | + | 1218 | WP_134493266.1 | plasmid partitioning protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..208728 | 208728 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15326.51 Da Isoelectric Point: 4.7306
>T288421 WP_134493258.1 NZ_LR536452:28367-28789 [Methylocella tundrae]
MNFLLDTNVLSEAQRPTPSARALAWLDAIDEDRVFLSVASIAELRRGVALLDEGRRRSALAAWLANDLPARFGGRILPID
QAVAERWGDLMAESRKTGTALSAMDGFFAATALARELTLVTRNVKDFAPFGVALLNPWED
MNFLLDTNVLSEAQRPTPSARALAWLDAIDEDRVFLSVASIAELRRGVALLDEGRRRSALAAWLANDLPARFGGRILPID
QAVAERWGDLMAESRKTGTALSAMDGFFAATALARELTLVTRNVKDFAPFGVALLNPWED
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|