Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 2017516..2018030 | Replicon | chromosome |
Accession | NZ_LR536450 | ||
Organism | Methylocella tundrae isolate MTUNDRAET4 annotated |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | MTUNDRAET4_RS09345 | Protein ID | WP_134489356.1 |
Coordinates | 2017704..2018030 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | MTUNDRAET4_RS09340 | Protein ID | WP_197731972.1 |
Coordinates | 2017516..2017704 (+) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTUNDRAET4_RS09305 | 2012989..2013405 | - | 417 | WP_134489340.1 | DUF1236 domain-containing protein | - |
MTUNDRAET4_RS09315 | 2013723..2014736 | - | 1014 | WP_134489345.1 | extensin family protein | - |
MTUNDRAET4_RS09320 | 2014831..2015253 | + | 423 | WP_134489347.1 | aminoacyl-tRNA hydrolase | - |
MTUNDRAET4_RS09325 | 2015299..2015795 | - | 497 | Protein_1840 | DUF2852 domain-containing protein | - |
MTUNDRAET4_RS09330 | 2015929..2016720 | - | 792 | WP_134489349.1 | inositol monophosphatase | - |
MTUNDRAET4_RS09335 | 2016717..2017289 | - | 573 | WP_134489351.1 | elongation factor P | - |
MTUNDRAET4_RS09340 | 2017516..2017704 | + | 189 | WP_197731972.1 | antitoxin MazE family protein | Antitoxin |
MTUNDRAET4_RS09345 | 2017704..2018030 | + | 327 | WP_134489356.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MTUNDRAET4_RS09350 | 2018226..2019530 | + | 1305 | WP_134489358.1 | hypothetical protein | - |
MTUNDRAET4_RS09355 | 2019625..2019741 | - | 117 | Protein_1846 | DNA polymerase III subunit beta | - |
MTUNDRAET4_RS09360 | 2020072..2020359 | + | 288 | WP_134489360.1 | co-chaperone GroES | - |
MTUNDRAET4_RS09365 | 2020408..2022051 | + | 1644 | WP_134489362.1 | chaperonin GroEL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11657.69 Da Isoelectric Point: 6.2655
>T288420 WP_134489356.1 NZ_LR536450:2017704-2018030 [Methylocella tundrae]
MKRGQFVVVATSGDYGKPRPALVMQSDLFAELPSAIICPLTTTLRDDADLFRLEVSPSPRNGLREISQIAIDKLTVVPIA
KIGDVIGQADDALLLRVNRALALFLGIV
MKRGQFVVVATSGDYGKPRPALVMQSDLFAELPSAIICPLTTTLRDDADLFRLEVSPSPRNGLREISQIAIDKLTVVPIA
KIGDVIGQADDALLLRVNRALALFLGIV
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|