Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | rlegTA/AbiEii-AbiEi |
Location | 1386878..1388411 | Replicon | chromosome |
Accession | NZ_LR536450 | ||
Organism | Methylocella tundrae isolate MTUNDRAET4 annotated |
Toxin (Protein)
Gene name | rlegT | Uniprot ID | - |
Locus tag | MTUNDRAET4_RS06590 | Protein ID | WP_134488443.1 |
Coordinates | 1386878..1387801 (-) | Length | 308 a.a. |
Antitoxin (Protein)
Gene name | rlegA | Uniprot ID | - |
Locus tag | MTUNDRAET4_RS06595 | Protein ID | WP_134488445.1 |
Coordinates | 1387791..1388411 (-) | Length | 207 a.a. |
Genomic Context
Location: 1382785..1383551 (767 bp)
Type: Others
Protein ID: WP_134488438.1
Type: Others
Protein ID: WP_134488438.1
Location: 1384824..1385480 (657 bp)
Type: Others
Protein ID: WP_134488441.1
Type: Others
Protein ID: WP_134488441.1
Location: 1385690..1385953 (264 bp)
Type: Others
Protein ID: WP_197732023.1
Type: Others
Protein ID: WP_197732023.1
Location: 1386100..1386450 (351 bp)
Type: Others
Protein ID: WP_134492383.1
Type: Others
Protein ID: WP_134492383.1
Location: 1392299..1393195 (897 bp)
Type: Others
Protein ID: WP_134488449.1
Type: Others
Protein ID: WP_134488449.1
Location: 1383567..1383989 (423 bp)
Type: Others
Protein ID: Protein_1293
Type: Others
Protein ID: Protein_1293
Location: 1384400..1384606 (207 bp)
Type: Others
Protein ID: WP_134488439.1
Type: Others
Protein ID: WP_134488439.1
Location: 1386878..1387801 (924 bp)
Type: Toxin
Protein ID: WP_134488443.1
Type: Toxin
Protein ID: WP_134488443.1
Location: 1387791..1388411 (621 bp)
Type: Antitoxin
Protein ID: WP_134488445.1
Type: Antitoxin
Protein ID: WP_134488445.1
Location: 1388569..1389294 (726 bp)
Type: Others
Protein ID: WP_166795885.1
Type: Others
Protein ID: WP_166795885.1
Location: 1389303..1390832 (1530 bp)
Type: Others
Protein ID: Protein_1301
Type: Others
Protein ID: Protein_1301
Location: 1390829..1391476 (648 bp)
Type: Others
Protein ID: Protein_1302
Type: Others
Protein ID: Protein_1302
Location: 1391779..1392213 (435 bp)
Type: Others
Protein ID: WP_197731955.1
Type: Others
Protein ID: WP_197731955.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTUNDRAET4_RS06555 | 1382785..1383551 | + | 767 | WP_134488438.1 | IS5 family transposase | - |
MTUNDRAET4_RS06560 | 1383567..1383989 | - | 423 | Protein_1293 | transposase | - |
MTUNDRAET4_RS06565 | 1384400..1384606 | - | 207 | WP_134488439.1 | hypothetical protein | - |
MTUNDRAET4_RS06575 | 1384824..1385480 | + | 657 | WP_134488441.1 | SDR family NAD(P)-dependent oxidoreductase | - |
MTUNDRAET4_RS06580 | 1385690..1385953 | + | 264 | WP_197732023.1 | DUF1778 domain-containing protein | - |
MTUNDRAET4_RS06585 | 1386100..1386450 | + | 351 | WP_134492383.1 | hypothetical protein | - |
MTUNDRAET4_RS06590 | 1386878..1387801 | - | 924 | WP_134488443.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | Toxin |
MTUNDRAET4_RS06595 | 1387791..1388411 | - | 621 | WP_134488445.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | Antitoxin |
MTUNDRAET4_RS06600 | 1388569..1389294 | - | 726 | WP_166795885.1 | M48 family metallopeptidase | - |
MTUNDRAET4_RS06605 | 1389303..1390832 | - | 1530 | Protein_1301 | DUF3387 domain-containing protein | - |
MTUNDRAET4_RS06610 | 1390829..1391476 | - | 648 | Protein_1302 | ParB/RepB/Spo0J family partition protein | - |
MTUNDRAET4_RS06615 | 1391779..1392213 | - | 435 | WP_197731955.1 | DUF4260 domain-containing protein | - |
MTUNDRAET4_RS06620 | 1392299..1393195 | + | 897 | WP_134488449.1 | LysR family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 308 a.a. Molecular weight: 34168.13 Da Isoelectric Point: 4.8849
>T288419 WP_134488443.1 NZ_LR536450:c1387801-1386878 [Methylocella tundrae]
MAHEPRKNVGASVRARLLDRSRVKRTDFQILLTRYALERLLYRLSLSLHRDRFILKGAMLFVTWVADPFRPTRDLDFLGY
GENSPEAIGEVFQEICGQPVDDDGVVFDIGAITAVPIREDVEYGGIRVRTSATIAGARIPIQVDIGFGDAVTPGPVEIVY
PPLLDAPAPHLRAYPVTTVVAEKFQALVLLGIANSRLKDFYDLWLIAQTFEFDRASLAEAVRQTFMRRGTMLPIEKPTGL
SDAYAEAWGRQWQAFLGRERMAAAPAELAVVVSDLAEFLLPLIEPAEGDERWKPSEGWRASDAGQDA
MAHEPRKNVGASVRARLLDRSRVKRTDFQILLTRYALERLLYRLSLSLHRDRFILKGAMLFVTWVADPFRPTRDLDFLGY
GENSPEAIGEVFQEICGQPVDDDGVVFDIGAITAVPIREDVEYGGIRVRTSATIAGARIPIQVDIGFGDAVTPGPVEIVY
PPLLDAPAPHLRAYPVTTVVAEKFQALVLLGIANSRLKDFYDLWLIAQTFEFDRASLAEAVRQTFMRRGTMLPIEKPTGL
SDAYAEAWGRQWQAFLGRERMAAAPAELAVVVSDLAEFLLPLIEPAEGDERWKPSEGWRASDAGQDA
Download Length: 924 bp
Antitoxin
Download Length: 207 a.a. Molecular weight: 22729.42 Da Isoelectric Point: 10.1007
>AT288419 WP_134488445.1 NZ_LR536450:c1388411-1387791 [Methylocella tundrae]
MTQMDSQRAQALKLLKACPMMRLKDFAAHGIGPETLARLVRDGAVVRPARGLYQLADSSGNAARILAEASALVPKGVICL
ISALQFHELTLQMPSAVWMAIDRTAWRPKIDYPPIRFVRFTGSSLTDGVERHSIEGIEVAITSPARTIVDCFRYRAKVGL
DVALEGLREGLRQRKVTSDQLWTYGTKGKVWSTMRPYVEATVADGT
MTQMDSQRAQALKLLKACPMMRLKDFAAHGIGPETLARLVRDGAVVRPARGLYQLADSSGNAARILAEASALVPKGVICL
ISALQFHELTLQMPSAVWMAIDRTAWRPKIDYPPIRFVRFTGSSLTDGVERHSIEGIEVAITSPARTIVDCFRYRAKVGL
DVALEGLREGLRQRKVTSDQLWTYGTKGKVWSTMRPYVEATVADGT
Download Length: 621 bp