Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 4079150..4079829 | Replicon | chromosome |
Accession | NZ_LR536431 | ||
Organism | Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
Locus tag | E4Z82_RS20450 | Protein ID | WP_003031349.1 |
Coordinates | 4079488..4079829 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
Locus tag | E4Z82_RS20445 | Protein ID | WP_003031347.1 |
Coordinates | 4079150..4079467 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z82_RS20410 | 4074395..4075507 | + | 1113 | WP_000005560.1 | His-Xaa-Ser system radical SAM maturase HxsC | - |
E4Z82_RS20415 | 4075504..4076139 | + | 636 | WP_001446059.1 | His-Xaa-Ser repeat protein HxsA | - |
E4Z82_RS20420 | 4076285..4077445 | - | 1161 | WP_023063357.1 | IS30 family transposase | - |
E4Z82_RS20425 | 4077744..4077935 | + | 192 | Protein_3932 | DUF905 domain-containing protein | - |
E4Z82_RS20430 | 4077949..4078410 | + | 462 | WP_003031344.1 | antirestriction protein | - |
E4Z82_RS20435 | 4078426..4078902 | + | 477 | WP_003031345.1 | RadC family protein | - |
E4Z82_RS20440 | 4078911..4079132 | + | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
E4Z82_RS20445 | 4079150..4079467 | + | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
E4Z82_RS20450 | 4079488..4079829 | + | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
E4Z82_RS20460 | 4080409..4081662 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
E4Z82_RS20465 | 4081674..4082777 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
E4Z82_RS20470 | 4083065..4084120 | + | 1056 | WP_000749861.1 | phosphoporin PhoE | - |
E4Z82_RS20475 | 4084159..4084560 | - | 402 | WP_000174677.1 | sigma factor-binding protein Crl | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T288417 WP_003031349.1 NZ_LR536431:4079488-4079829 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLJ2 |