Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3850783..3851401 | Replicon | chromosome |
Accession | NZ_LR536431 | ||
Organism | Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | E4Z82_RS19335 | Protein ID | WP_001291435.1 |
Coordinates | 3851183..3851401 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | E4Z82_RS19330 | Protein ID | WP_000344800.1 |
Coordinates | 3850783..3851157 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z82_RS19320 | 3845872..3847065 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
E4Z82_RS19325 | 3847088..3850237 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
E4Z82_RS19330 | 3850783..3851157 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
E4Z82_RS19335 | 3851183..3851401 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
E4Z82_RS19340 | 3851573..3852124 | + | 552 | WP_000102569.1 | maltose O-acetyltransferase | - |
E4Z82_RS19345 | 3852240..3852710 | + | 471 | WP_000136192.1 | YlaC family protein | - |
E4Z82_RS19350 | 3852991..3853959 | - | 969 | WP_000654812.1 | IS5-like element IS903B family transposase | - |
E4Z82_RS19355 | 3853979..3855490 | + | 1512 | WP_050487596.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
E4Z82_RS19360 | 3855532..3855885 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3852991..3853914 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288416 WP_001291435.1 NZ_LR536431:3851183-3851401 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT288416 WP_000344800.1 NZ_LR536431:3850783-3851157 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |