Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 2624373..2625016 Replicon chromosome
Accession NZ_LR536431
Organism Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag E4Z82_RS13120 Protein ID WP_088765932.1
Coordinates 2624373..2624789 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag E4Z82_RS13125 Protein ID WP_001261282.1
Coordinates 2624786..2625016 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4Z82_RS13080 2619794..2620588 + 795 Protein_2515 replication initiator protein RepA -
E4Z82_RS13085 2621161..2621403 + 243 WP_000124732.1 type II toxin-antitoxin system ParD family antitoxin -
E4Z82_RS13090 2621396..2621680 + 285 WP_000277490.1 type II toxin-antitoxin system RelE/ParE family toxin -
E4Z82_RS13095 2621818..2621910 - 93 Protein_2518 DNA partition complex ParG -
E4Z82_RS25585 2622416..2622748 - 333 Protein_2519 glycogen/starch synthase -
E4Z82_RS13105 2622748..2623269 - 522 Protein_2520 glucose-1-phosphate adenylyltransferase -
E4Z82_RS13110 2623332..2624036 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
E4Z82_RS13115 2624084..2624275 + 192 WP_001446477.1 helix-turn-helix domain-containing protein -
E4Z82_RS13120 2624373..2624789 - 417 WP_088765932.1 type II toxin-antitoxin system VapC family toxin Toxin
E4Z82_RS13125 2624786..2625016 - 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
E4Z82_RS13130 2624973..2625434 + 462 WP_162535865.1 hypothetical protein -
E4Z82_RS13135 2625578..2625928 + 351 WP_000493399.1 hypothetical protein -
E4Z82_RS13140 2626088..2626885 - 798 WP_000544830.1 IS21-like element IS21 family helper ATPase IstB -
E4Z82_RS13145 2626885..2628057 - 1173 WP_042111630.1 IS21-like element IS21 family transposase -
E4Z82_RS13150 2628143..2628322 + 180 Protein_2529 hypothetical protein -
E4Z82_RS13160 2628374..2629085 - 712 Protein_2530 IS6 family transposase -
E4Z82_RS13170 2629154..2629594 + 441 Protein_2531 ISNCY family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2607706..2644380 36674
- inside IScluster/Tn - - 2617058..2655790 38732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15164.56 Da        Isoelectric Point: 6.4581

>T288414 WP_088765932.1 NZ_LR536431:c2624789-2624373 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPDLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT288414 WP_001261282.1 NZ_LR536431:c2625016-2624786 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References