Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 2624373..2625016 | Replicon | chromosome |
| Accession | NZ_LR536431 | ||
| Organism | Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | E4Z82_RS13120 | Protein ID | WP_088765932.1 |
| Coordinates | 2624373..2624789 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | E4Z82_RS13125 | Protein ID | WP_001261282.1 |
| Coordinates | 2624786..2625016 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4Z82_RS13080 | 2619794..2620588 | + | 795 | Protein_2515 | replication initiator protein RepA | - |
| E4Z82_RS13085 | 2621161..2621403 | + | 243 | WP_000124732.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| E4Z82_RS13090 | 2621396..2621680 | + | 285 | WP_000277490.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| E4Z82_RS13095 | 2621818..2621910 | - | 93 | Protein_2518 | DNA partition complex ParG | - |
| E4Z82_RS25585 | 2622416..2622748 | - | 333 | Protein_2519 | glycogen/starch synthase | - |
| E4Z82_RS13105 | 2622748..2623269 | - | 522 | Protein_2520 | glucose-1-phosphate adenylyltransferase | - |
| E4Z82_RS13110 | 2623332..2624036 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| E4Z82_RS13115 | 2624084..2624275 | + | 192 | WP_001446477.1 | helix-turn-helix domain-containing protein | - |
| E4Z82_RS13120 | 2624373..2624789 | - | 417 | WP_088765932.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| E4Z82_RS13125 | 2624786..2625016 | - | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| E4Z82_RS13130 | 2624973..2625434 | + | 462 | WP_162535865.1 | hypothetical protein | - |
| E4Z82_RS13135 | 2625578..2625928 | + | 351 | WP_000493399.1 | hypothetical protein | - |
| E4Z82_RS13140 | 2626088..2626885 | - | 798 | WP_000544830.1 | IS21-like element IS21 family helper ATPase IstB | - |
| E4Z82_RS13145 | 2626885..2628057 | - | 1173 | WP_042111630.1 | IS21-like element IS21 family transposase | - |
| E4Z82_RS13150 | 2628143..2628322 | + | 180 | Protein_2529 | hypothetical protein | - |
| E4Z82_RS13160 | 2628374..2629085 | - | 712 | Protein_2530 | IS6 family transposase | - |
| E4Z82_RS13170 | 2629154..2629594 | + | 441 | Protein_2531 | ISNCY family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2607706..2644380 | 36674 | |
| - | inside | IScluster/Tn | - | - | 2617058..2655790 | 38732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15164.56 Da Isoelectric Point: 6.4581
>T288414 WP_088765932.1 NZ_LR536431:c2624789-2624373 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPDLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPDLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|