Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2621161..2621680 Replicon chromosome
Accession NZ_LR536431
Organism Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8

Toxin (Protein)


Gene name parE Uniprot ID A0A837F4A9
Locus tag E4Z82_RS13090 Protein ID WP_000277490.1
Coordinates 2621396..2621680 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A6P1V8C3
Locus tag E4Z82_RS13085 Protein ID WP_000124732.1
Coordinates 2621161..2621403 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4Z82_RS13060 2616886..2616996 + 111 Protein_2512 recombinase family protein -
E4Z82_RS13070 2617058..2617762 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
E4Z82_RS13075 2617824..2619758 + 1935 Protein_2514 Tn3 family transposase -
E4Z82_RS13080 2619794..2620588 + 795 Protein_2515 replication initiator protein RepA -
E4Z82_RS13085 2621161..2621403 + 243 WP_000124732.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
E4Z82_RS13090 2621396..2621680 + 285 WP_000277490.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
E4Z82_RS13095 2621818..2621910 - 93 Protein_2518 DNA partition complex ParG -
E4Z82_RS25585 2622416..2622748 - 333 Protein_2519 glycogen/starch synthase -
E4Z82_RS13105 2622748..2623269 - 522 Protein_2520 glucose-1-phosphate adenylyltransferase -
E4Z82_RS13110 2623332..2624036 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
E4Z82_RS13115 2624084..2624275 + 192 WP_001446477.1 helix-turn-helix domain-containing protein -
E4Z82_RS13120 2624373..2624789 - 417 WP_088765932.1 type II toxin-antitoxin system VapC family toxin -
E4Z82_RS13125 2624786..2625016 - 231 WP_001261282.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
E4Z82_RS13130 2624973..2625434 + 462 WP_162535865.1 hypothetical protein -
E4Z82_RS13135 2625578..2625928 + 351 WP_000493399.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2607706..2644380 36674
- inside IScluster/Tn - - 2617058..2655790 38732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11005.52 Da        Isoelectric Point: 6.2103

>T288413 WP_000277490.1 NZ_LR536431:2621396-2621680 [Escherichia coli]
VYKLTERAADDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHTVPGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8875.01 Da        Isoelectric Point: 7.0130

>AT288413 WP_000124732.1 NZ_LR536431:2621161-2621403 [Escherichia coli]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVIAGLESGESSLSLRDIAAQRKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837F4A9

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V8C3

References