Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3614866..3615545 | Replicon | chromosome |
| Accession | NZ_LR536430 | ||
| Organism | Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | E4Z69_RS17995 | Protein ID | WP_000854680.1 |
| Coordinates | 3614866..3615207 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | E4Z69_RS18000 | Protein ID | WP_000070396.1 |
| Coordinates | 3615228..3615545 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4Z69_RS17980 | 3610642..3611762 | + | 1121 | WP_087451024.1 | IS3-like element ISSen4 family transposase | - |
| E4Z69_RS17985 | 3611844..3612263 | + | 420 | WP_001333214.1 | hypothetical protein | - |
| E4Z69_RS17990 | 3612579..3614045 | + | 1467 | WP_000723924.1 | hypothetical protein | - |
| E4Z69_RS17995 | 3614866..3615207 | - | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| E4Z69_RS18000 | 3615228..3615545 | - | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| E4Z69_RS18005 | 3615564..3615785 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| E4Z69_RS18010 | 3615794..3616270 | - | 477 | WP_001549015.1 | RadC family protein | - |
| E4Z69_RS18015 | 3616286..3616744 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| E4Z69_RS18020 | 3616842..3617081 | - | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| E4Z69_RS18025 | 3617158..3617625 | - | 468 | WP_001385283.1 | hypothetical protein | - |
| E4Z69_RS18030 | 3617648..3618091 | - | 444 | WP_000649865.1 | hypothetical protein | - |
| E4Z69_RS18035 | 3618091..3618327 | - | 237 | WP_001144031.1 | hypothetical protein | - |
| E4Z69_RS18040 | 3618368..3619069 | - | 702 | WP_000189411.1 | WYL domain-containing protein | - |
| E4Z69_RS18045 | 3619286..3620107 | - | 822 | WP_000197388.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3574627..3643206 | 68579 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T288399 WP_000854680.1 NZ_LR536430:c3615207-3614866 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|