Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3309258..3309808 Replicon chromosome
Accession NZ_LR536430
Organism Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8

Toxin (Protein)


Gene name ccdB Uniprot ID D7Y6T6
Locus tag E4Z69_RS16435 Protein ID WP_001160971.1
Coordinates 3309494..3309808 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag E4Z69_RS16430 Protein ID WP_000125566.1
Coordinates 3309258..3309491 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4Z69_RS16405 3304329..3304616 + 288 WP_000203741.1 ferredoxin-like protein FixX -
E4Z69_RS16410 3304674..3306005 + 1332 WP_001183198.1 MFS transporter -
E4Z69_RS16415 3306116..3306646 + 531 WP_000600718.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
E4Z69_RS16420 3306639..3308501 + 1863 WP_000377188.1 glutathione-regulated potassium-efflux system protein KefC -
E4Z69_RS16425 3308693..3309172 + 480 WP_001487721.1 type 3 dihydrofolate reductase -
E4Z69_RS16430 3309258..3309491 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
E4Z69_RS16435 3309494..3309808 + 315 WP_001160971.1 CcdB family protein Toxin
E4Z69_RS16440 3309805..3310653 - 849 WP_000257189.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
E4Z69_RS16445 3310660..3311037 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
E4Z69_RS16450 3311040..3311861 - 822 WP_001065392.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
E4Z69_RS16455 3311858..3312847 - 990 WP_000241253.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
E4Z69_RS16460 3312847..3314133 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11741.75 Da        Isoelectric Point: 9.0851

>T288397 WP_001160971.1 NZ_LR536430:3309494-3309808 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT288397 WP_000125566.1 NZ_LR536430:3309258-3309491 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A241QVQ9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References