Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3123661..3124256 | Replicon | chromosome |
Accession | NZ_LR536430 | ||
Organism | Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | E4Z69_RS15540 | Protein ID | WP_000239581.1 |
Coordinates | 3123906..3124256 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | E4Z69_RS15535 | Protein ID | WP_001223213.1 |
Coordinates | 3123661..3123912 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z69_RS15525 | 3119326..3123105 | + | 3780 | WP_001548968.1 | autotransporter assembly complex protein TamB | - |
E4Z69_RS15530 | 3123108..3123449 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
E4Z69_RS15535 | 3123661..3123912 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
E4Z69_RS15540 | 3123906..3124256 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
E4Z69_RS15545 | 3124335..3124865 | - | 531 | WP_000055072.1 | inorganic diphosphatase | - |
E4Z69_RS15550 | 3125175..3126131 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
E4Z69_RS15555 | 3126269..3127771 | + | 1503 | WP_001095667.1 | sugar ABC transporter ATP-binding protein | - |
E4Z69_RS15560 | 3127785..3128807 | + | 1023 | WP_001548970.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T288395 WP_000239581.1 NZ_LR536430:3123906-3124256 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|