Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4622149..4622984 | Replicon | chromosome |
Accession | NZ_LR217818 | ||
Organism | Escherichia coli strain NCTC86 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A5F0P695 |
Locus tag | E4V11_RS22650 | Protein ID | WP_022645116.1 |
Coordinates | 4622607..4622984 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | Q5I3J0 |
Locus tag | E4V11_RS22645 | Protein ID | WP_001280951.1 |
Coordinates | 4622149..4622517 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4V11_RS22610 | 4617813..4618493 | + | 681 | WP_001282921.1 | WYL domain-containing protein | - |
E4V11_RS22615 | 4618641..4619318 | + | 678 | WP_001097302.1 | hypothetical protein | - |
E4V11_RS22620 | 4619324..4619557 | + | 234 | WP_001278293.1 | DUF905 family protein | - |
E4V11_RS22625 | 4619647..4620465 | + | 819 | WP_001175165.1 | DUF945 domain-containing protein | - |
E4V11_RS22630 | 4620731..4621210 | + | 480 | WP_001564060.1 | antirestriction protein | - |
E4V11_RS22635 | 4621226..4621702 | + | 477 | WP_001186786.1 | RadC family protein | - |
E4V11_RS22640 | 4621765..4621986 | + | 222 | WP_021532904.1 | DUF987 domain-containing protein | - |
E4V11_RS22645 | 4622149..4622517 | + | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
E4V11_RS22650 | 4622607..4622984 | + | 378 | WP_022645116.1 | TA system toxin CbtA family protein | Toxin |
E4V11_RS22655 | 4622981..4623130 | + | 150 | Protein_4357 | hypothetical protein | - |
E4V11_RS22660 | 4623209..4623403 | + | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
E4V11_RS22665 | 4623488..4624330 | + | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
E4V11_RS22670 | 4625079..4626618 | + | 1540 | Protein_4360 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4588659..4634430 | 45771 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14021.99 Da Isoelectric Point: 7.8045
>T288370 WP_022645116.1 NZ_LR217818:4622607-4622984 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13699.56 Da Isoelectric Point: 7.0268
>AT288370 WP_001280951.1 NZ_LR217818:4622149-4622517 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5F0P695 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q5I3J0 |