Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4343806..4344638 | Replicon | chromosome |
| Accession | NZ_LR217818 | ||
| Organism | Escherichia coli strain NCTC86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | E4V11_RS21115 | Protein ID | WP_058101701.1 |
| Coordinates | 4343806..4344180 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | E4V11_RS21120 | Protein ID | WP_001540478.1 |
| Coordinates | 4344270..4344638 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V11_RS21095 | 4339323..4342214 | - | 2892 | WP_000580534.1 | DEAD/DEAH box helicase family protein | - |
| E4V11_RS25100 | 4342867..4343025 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| E4V11_RS21105 | 4343125..4343301 | - | 177 | WP_001586605.1 | DUF957 domain-containing protein | - |
| E4V11_RS21110 | 4343318..4343809 | - | 492 | WP_001586604.1 | hypothetical protein | - |
| E4V11_RS21115 | 4343806..4344180 | - | 375 | WP_058101701.1 | TA system toxin CbtA family protein | Toxin |
| E4V11_RS21120 | 4344270..4344638 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E4V11_RS21125 | 4344801..4345022 | - | 222 | WP_021532904.1 | DUF987 domain-containing protein | - |
| E4V11_RS21130 | 4345085..4345561 | - | 477 | WP_001186786.1 | RadC family protein | - |
| E4V11_RS21135 | 4345577..4346050 | - | 474 | WP_068879497.1 | antirestriction protein | - |
| E4V11_RS21140 | 4346216..4346389 | - | 174 | WP_001183321.1 | hypothetical protein | - |
| E4V11_RS21145 | 4346389..4347207 | - | 819 | WP_134388481.1 | DUF945 domain-containing protein | - |
| E4V11_RS21155 | 4347374..4347520 | - | 147 | WP_059333225.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13796.72 Da Isoelectric Point: 7.9047
>T288369 WP_058101701.1 NZ_LR217818:c4344180-4343806 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT288369 WP_001540478.1 NZ_LR217818:c4344638-4344270 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|