Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3377304..3378136 | Replicon | chromosome |
| Accession | NZ_LR217818 | ||
| Organism | Escherichia coli strain NCTC86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | E4V11_RS16720 | Protein ID | WP_000854765.1 |
| Coordinates | 3377762..3378136 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | E4V11_RS16715 | Protein ID | WP_001360327.1 |
| Coordinates | 3377304..3377672 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V11_RS16680 | 3372893..3374464 | - | 1572 | WP_000381395.1 | IS66 family transposase | - |
| E4V11_RS16685 | 3374484..3374831 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| E4V11_RS16690 | 3374831..3375508 | - | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| E4V11_RS16700 | 3375892..3376365 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| E4V11_RS16705 | 3376381..3376857 | + | 477 | WP_001186774.1 | RadC family protein | - |
| E4V11_RS16710 | 3376920..3377141 | + | 222 | WP_023356553.1 | DUF987 domain-containing protein | - |
| E4V11_RS16715 | 3377304..3377672 | + | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E4V11_RS16720 | 3377762..3378136 | + | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| E4V11_RS16725 | 3378133..3378339 | + | 207 | WP_000976829.1 | hypothetical protein | - |
| E4V11_RS16730 | 3378352..3378465 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| E4V11_RS16735 | 3378729..3379475 | - | 747 | Protein_3218 | IS21-like element ISEc12 family helper ATPase IstB | - |
| E4V11_RS16740 | 3379490..3381031 | - | 1542 | WP_001445980.1 | IS21-like element ISEc12 family transposase | - |
| E4V11_RS25090 | 3381849..3382238 | + | 390 | WP_077249349.1 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 3372893..3384377 | 11484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T288366 WP_000854765.1 NZ_LR217818:3377762-3378136 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT288366 WP_001360327.1 NZ_LR217818:3377304-3377672 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A7ZVJ9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |