Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2329244..2330042 | Replicon | chromosome |
| Accession | NZ_LR217818 | ||
| Organism | Escherichia coli strain NCTC86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | E4V11_RS11360 | Protein ID | WP_066009386.1 |
| Coordinates | 2329665..2330042 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7UP42 |
| Locus tag | E4V11_RS11355 | Protein ID | WP_001280955.1 |
| Coordinates | 2329244..2329618 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V11_RS11320 | 2324599..2325504 | + | 906 | WP_000203541.1 | chemotaxis protein | - |
| E4V11_RS11325 | 2325501..2326571 | + | 1071 | WP_053886242.1 | patatin-like phospholipase family protein | - |
| E4V11_RS11335 | 2326911..2327729 | + | 819 | WP_001234682.1 | DUF945 domain-containing protein | - |
| E4V11_RS11340 | 2327820..2328305 | + | 486 | WP_023910464.1 | antirestriction protein | - |
| E4V11_RS11345 | 2328321..2328797 | + | 477 | WP_001186192.1 | RadC family protein | - |
| E4V11_RS11350 | 2328860..2329081 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| E4V11_RS11355 | 2329244..2329618 | + | 375 | WP_001280955.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E4V11_RS11360 | 2329665..2330042 | + | 378 | WP_066009386.1 | TA system toxin CbtA family protein | Toxin |
| E4V11_RS11365 | 2330039..2330527 | + | 489 | WP_044704957.1 | hypothetical protein | - |
| E4V11_RS11370 | 2330539..2330634 | + | 96 | WP_023910462.1 | DUF957 domain-containing protein | - |
| E4V11_RS11375 | 2330683..2331438 | - | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| E4V11_RS11380 | 2331435..2332934 | - | 1500 | WP_001735705.1 | IS21-like element ISEc10 family transposase | - |
| E4V11_RS11385 | 2332988..2333815 | + | 828 | WP_031326415.1 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgG / csgF / csgE / csgD / csgB / csgA / csgC | 2329244..2342754 | 13510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14247.32 Da Isoelectric Point: 8.2905
>T288356 WP_066009386.1 NZ_LR217818:2329665-2330042 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13767.59 Da Isoelectric Point: 6.6248
>AT288356 WP_001280955.1 NZ_LR217818:2329244-2329618 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|