Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2329244..2330042 Replicon chromosome
Accession NZ_LR217818
Organism Escherichia coli strain NCTC86

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag E4V11_RS11360 Protein ID WP_066009386.1
Coordinates 2329665..2330042 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7UP42
Locus tag E4V11_RS11355 Protein ID WP_001280955.1
Coordinates 2329244..2329618 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4V11_RS11320 2324599..2325504 + 906 WP_000203541.1 chemotaxis protein -
E4V11_RS11325 2325501..2326571 + 1071 WP_053886242.1 patatin-like phospholipase family protein -
E4V11_RS11335 2326911..2327729 + 819 WP_001234682.1 DUF945 domain-containing protein -
E4V11_RS11340 2327820..2328305 + 486 WP_023910464.1 antirestriction protein -
E4V11_RS11345 2328321..2328797 + 477 WP_001186192.1 RadC family protein -
E4V11_RS11350 2328860..2329081 + 222 WP_001220314.1 DUF987 domain-containing protein -
E4V11_RS11355 2329244..2329618 + 375 WP_001280955.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
E4V11_RS11360 2329665..2330042 + 378 WP_066009386.1 TA system toxin CbtA family protein Toxin
E4V11_RS11365 2330039..2330527 + 489 WP_044704957.1 hypothetical protein -
E4V11_RS11370 2330539..2330634 + 96 WP_023910462.1 DUF957 domain-containing protein -
E4V11_RS11375 2330683..2331438 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
E4V11_RS11380 2331435..2332934 - 1500 WP_001735705.1 IS21-like element ISEc10 family transposase -
E4V11_RS11385 2332988..2333815 + 828 WP_031326415.1 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgG / csgF / csgE / csgD / csgB / csgA / csgC 2329244..2342754 13510


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14247.32 Da        Isoelectric Point: 8.2905

>T288356 WP_066009386.1 NZ_LR217818:2329665-2330042 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13767.59 Da        Isoelectric Point: 6.6248

>AT288356 WP_001280955.1 NZ_LR217818:2329244-2329618 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9P0D0

References