Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2118110..2118954 | Replicon | chromosome |
Accession | NZ_LR217818 | ||
Organism | Escherichia coli strain NCTC86 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | E4V11_RS10375 | Protein ID | WP_000854686.1 |
Coordinates | 2118571..2118954 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
Locus tag | E4V11_RS10370 | Protein ID | WP_001285602.1 |
Coordinates | 2118110..2118490 (+) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4V11_RS10330 | 2114358..2114813 | + | 456 | WP_000581502.1 | hypothetical protein | - |
E4V11_RS10335 | 2114892..2115125 | + | 234 | WP_001119727.1 | DUF905 family protein | - |
E4V11_RS10345 | 2115226..2116044 | + | 819 | WP_068879456.1 | DUF945 domain-containing protein | - |
E4V11_RS10350 | 2116136..2116621 | + | 486 | WP_000214307.1 | antirestriction protein | - |
E4V11_RS10355 | 2116637..2117113 | + | 477 | WP_021543704.1 | RadC family protein | - |
E4V11_RS10360 | 2117176..2117397 | + | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
E4V11_RS10365 | 2117416..2118099 | + | 684 | WP_000086768.1 | hypothetical protein | - |
E4V11_RS10370 | 2118110..2118490 | + | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
E4V11_RS10375 | 2118571..2118954 | + | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
E4V11_RS10380 | 2118951..2119439 | + | 489 | WP_001054233.1 | hypothetical protein | - |
E4V11_RS10385 | 2119456..2119653 | + | 198 | WP_000839256.1 | DUF957 domain-containing protein | - |
E4V11_RS10390 | 2119738..2120580 | + | 843 | WP_068879455.1 | DUF4942 domain-containing protein | - |
E4V11_RS10400 | 2121072..2121290 | - | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
E4V11_RS10405 | 2121575..2122279 | - | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T288355 WP_000854686.1 NZ_LR217818:2118571-2118954 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT288355 WP_001285602.1 NZ_LR217818:2118110-2118490 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|