Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1567842..1568460 | Replicon | chromosome |
Accession | NZ_LR217818 | ||
Organism | Escherichia coli strain NCTC86 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | E4V11_RS07675 | Protein ID | WP_001291435.1 |
Coordinates | 1567842..1568060 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | E4V11_RS07680 | Protein ID | WP_000344800.1 |
Coordinates | 1568086..1568460 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4V11_RS07645 | 1563015..1563635 | + | 621 | WP_001267012.1 | recombinase family protein | - |
E4V11_RS07650 | 1563853..1564080 | + | 228 | WP_024183738.1 | DUF2188 domain-containing protein | - |
E4V11_RS07655 | 1564424..1564777 | + | 354 | WP_016246925.1 | DUF1428 family protein | - |
E4V11_RS07660 | 1564819..1566369 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
E4V11_RS07665 | 1566533..1567003 | - | 471 | WP_000136192.1 | YlaC family protein | - |
E4V11_RS07670 | 1567119..1567670 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
E4V11_RS07675 | 1567842..1568060 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
E4V11_RS07680 | 1568086..1568460 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
E4V11_RS07685 | 1569006..1572155 | - | 3150 | WP_066009150.1 | efflux RND transporter permease AcrB | - |
E4V11_RS07690 | 1572178..1573371 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288353 WP_001291435.1 NZ_LR217818:c1568060-1567842 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT288353 WP_000344800.1 NZ_LR217818:c1568460-1568086 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |