Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1373048..1373742 | Replicon | chromosome |
| Accession | NZ_LR217818 | ||
| Organism | Escherichia coli strain NCTC86 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | E4V11_RS06750 | Protein ID | WP_066009356.1 |
| Coordinates | 1373374..1373742 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | E4V11_RS06745 | Protein ID | WP_077249034.1 |
| Coordinates | 1373048..1373353 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V11_RS06700 | 1368998..1369453 | + | 456 | WP_000581506.1 | hypothetical protein | - |
| E4V11_RS06705 | 1369554..1369762 | + | 209 | Protein_1286 | DUF905 domain-containing protein | - |
| E4V11_RS06715 | 1369863..1370684 | + | 822 | WP_001234565.1 | DUF945 domain-containing protein | - |
| E4V11_RS06725 | 1371026..1371499 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| E4V11_RS06730 | 1371515..1371991 | + | 477 | WP_001424026.1 | RadC family protein | - |
| E4V11_RS06735 | 1372060..1372281 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| E4V11_RS06740 | 1372300..1372944 | + | 645 | WP_000086755.1 | hypothetical protein | - |
| E4V11_RS06745 | 1373048..1373353 | + | 306 | WP_077249034.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E4V11_RS06750 | 1373374..1373742 | + | 369 | WP_066009356.1 | TA system toxin CbtA family protein | Toxin |
| E4V11_RS06755 | 1374063..1374401 | - | 339 | Protein_1294 | LysR family transcriptional regulator | - |
| E4V11_RS06760 | 1374452..1375408 | - | 957 | WP_000121359.1 | molybdenum cofactor insertion chaperone PaoD | - |
| E4V11_RS06765 | 1375418..1377616 | - | 2199 | WP_000667026.1 | aldehyde oxidoreductase molybdenum-binding subunit PaoC | - |
| E4V11_RS06770 | 1377613..1378569 | - | 957 | WP_000643333.1 | aldehyde oxidoreductase FAD-binding subunit PaoB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13611.75 Da Isoelectric Point: 7.7465
>T288352 WP_066009356.1 NZ_LR217818:1373374-1373742 [Escherichia coli]
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDASITLANAVNFLVEKYELVRIDRNGF
NSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDASITLANAVNFLVEKYELVRIDRNGF
NSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|