Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 829984..830779 | Replicon | chromosome |
| Accession | NZ_LR217818 | ||
| Organism | Escherichia coli strain NCTC86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | E4V11_RS03975 | Protein ID | WP_068879483.1 |
| Coordinates | 829984..830358 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | E4V11_RS03980 | Protein ID | WP_001522275.1 |
| Coordinates | 830405..830779 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V11_RS03945 | 825237..826220 | - | 984 | WP_066008910.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| E4V11_RS24900 | 827031..827186 | - | 156 | WP_000729639.1 | hypothetical protein | - |
| E4V11_RS03950 | 827678..828004 | - | 327 | WP_001522265.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| E4V11_RS03955 | 828001..828264 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| E4V11_RS03960 | 828336..829202 | - | 867 | WP_023909479.1 | DUF4942 domain-containing protein | - |
| E4V11_RS03965 | 829287..829484 | - | 198 | WP_001522268.1 | DUF957 domain-containing protein | - |
| E4V11_RS03970 | 829496..829987 | - | 492 | WP_001522269.1 | hypothetical protein | - |
| E4V11_RS03975 | 829984..830358 | - | 375 | WP_068879483.1 | TA system toxin CbtA family protein | Toxin |
| E4V11_RS03980 | 830405..830779 | - | 375 | WP_001522275.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| E4V11_RS03985 | 830859..831080 | - | 222 | WP_023909484.1 | DUF987 domain-containing protein | - |
| E4V11_RS03990 | 831132..831887 | - | 756 | WP_001522280.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| E4V11_RS03995 | 831884..833383 | - | 1500 | WP_001522281.1 | IS21-like element ISEc10 family transposase | - |
| E4V11_RS04000 | 833564..834040 | - | 477 | WP_001186724.1 | RadC family protein | - |
| E4V11_RS04005 | 834055..834528 | - | 474 | WP_001522284.1 | antirestriction protein | - |
| E4V11_RS24905 | 834623..834799 | - | 177 | WP_001522285.1 | hypothetical protein | - |
| E4V11_RS04010 | 834799..835617 | - | 819 | WP_001522287.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | rfaE / gspK / gspL / gspM / kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / draA | 716973..865741 | 148768 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14026.02 Da Isoelectric Point: 8.2905
>T288347 WP_068879483.1 NZ_LR217818:c830358-829984 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13630.35 Da Isoelectric Point: 5.5051
>AT288347 WP_001522275.1 NZ_LR217818:c830779-830405 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|