Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 829984..830779 Replicon chromosome
Accession NZ_LR217818
Organism Escherichia coli strain NCTC86

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag E4V11_RS03975 Protein ID WP_068879483.1
Coordinates 829984..830358 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag E4V11_RS03980 Protein ID WP_001522275.1
Coordinates 830405..830779 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4V11_RS03945 825237..826220 - 984 WP_066008910.1 KpsF/GutQ family sugar-phosphate isomerase -
E4V11_RS24900 827031..827186 - 156 WP_000729639.1 hypothetical protein -
E4V11_RS03950 827678..828004 - 327 WP_001522265.1 type II toxin-antitoxin system RelE/ParE family toxin -
E4V11_RS03955 828001..828264 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
E4V11_RS03960 828336..829202 - 867 WP_023909479.1 DUF4942 domain-containing protein -
E4V11_RS03965 829287..829484 - 198 WP_001522268.1 DUF957 domain-containing protein -
E4V11_RS03970 829496..829987 - 492 WP_001522269.1 hypothetical protein -
E4V11_RS03975 829984..830358 - 375 WP_068879483.1 TA system toxin CbtA family protein Toxin
E4V11_RS03980 830405..830779 - 375 WP_001522275.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
E4V11_RS03985 830859..831080 - 222 WP_023909484.1 DUF987 domain-containing protein -
E4V11_RS03990 831132..831887 - 756 WP_001522280.1 IS21-like element ISEc10 family helper ATPase IstB -
E4V11_RS03995 831884..833383 - 1500 WP_001522281.1 IS21-like element ISEc10 family transposase -
E4V11_RS04000 833564..834040 - 477 WP_001186724.1 RadC family protein -
E4V11_RS04005 834055..834528 - 474 WP_001522284.1 antirestriction protein -
E4V11_RS24905 834623..834799 - 177 WP_001522285.1 hypothetical protein -
E4V11_RS04010 834799..835617 - 819 WP_001522287.1 DUF945 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspK / gspL / gspM / kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / draA 716973..865741 148768


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14026.02 Da        Isoelectric Point: 8.2905

>T288347 WP_068879483.1 NZ_LR217818:c830358-829984 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13630.35 Da        Isoelectric Point: 5.5051

>AT288347 WP_001522275.1 NZ_LR217818:c830779-830405 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References