Detailed information of TA system TA288347

Bioinformatically predicted

Overview

TA module

• Type: IV
• Classification (family/domain): yeeUV (cbtA-cbeA)/CbtA-CbeA
• Location: 829984..830779
• Replicon: chromosome
• Accession: NZ_LR217818
• Organism: Escherichia coli strain NCTC86

Toxin (Protein)

• Gene name: yeeV
• Uniprot ID: -
• Locus tag: E4V11_RS03975
• Protein ID: WP_068879483.1
• Coordinates: 829984..830358 (-)
• Length: 125 a.a.

Antitoxin (Protein)

• Gene name: yeeU
• Uniprot ID: -
• Locus tag: E4V11_RS03980
• Protein ID: WP_001522275.1
• Coordinates: 830405..830779 (-)
• Length: 125 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E4V11_RS03945	825237..826220	-	984	WP_066008910.1	KpsF/GutQ family sugar-phosphate isomerase	-
E4V11_RS24900	827031..827186	-	156	WP_000729639.1	hypothetical protein	-
E4V11_RS03950	827678..828004	-	327	WP_001522265.1	type II toxin-antitoxin system RelE/ParE family toxin	-
E4V11_RS03955	828001..828264	-	264	WP_001143297.1	type II toxin-antitoxin system ParD family antitoxin	-
E4V11_RS03960	828336..829202	-	867	WP_023909479.1	DUF4942 domain-containing protein	-
E4V11_RS03965	829287..829484	-	198	WP_001522268.1	DUF957 domain-containing protein	-
E4V11_RS03970	829496..829987	-	492	WP_001522269.1	hypothetical protein	-
E4V11_RS03975	829984..830358	-	375	WP_068879483.1	TA system toxin CbtA family protein	Toxin
E4V11_RS03980	830405..830779	-	375	WP_001522275.1	type IV toxin-antitoxin system toxin CbtA	Antitoxin
E4V11_RS03985	830859..831080	-	222	WP_023909484.1	DUF987 domain-containing protein	-
E4V11_RS03990	831132..831887	-	756	WP_001522280.1	IS21-like element ISEc10 family helper ATPase IstB	-
E4V11_RS03995	831884..833383	-	1500	WP_001522281.1	IS21-like element ISEc10 family transposase	-
E4V11_RS04000	833564..834040	-	477	WP_001186724.1	RadC family protein	-
E4V11_RS04005	834055..834528	-	474	WP_001522284.1	antirestriction protein	-
E4V11_RS24905	834623..834799	-	177	WP_001522285.1	hypothetical protein	-
E4V11_RS04010	834799..835617	-	819	WP_001522287.1	DUF945 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	rfaE / gspK / gspL / gspM / kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / draA	716973..865741	148768

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• CbtA toxin of type IV toxin-antitoxin system (1-112)

Antitoxin

• Antitoxin CbeA (19-117)

Sequences

Toxin

Protein

• Length: 125 a.a.
• Molecular weight: 14026.02 Da
• Isoelectric Point: 8.2905

>T288347 WP_068879483.1 NZ_LR217818:c830358-829984 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK

Nucleotide

• Length: 375 bp

Antitoxin

Protein

• Length: 125 a.a.
• Molecular weight: 13630.35 Da
• Isoelectric Point: 5.5051

>AT288347 WP_001522275.1 NZ_LR217818:c830779-830405 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Nucleotide

• Length: 375 bp