Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1620649..1621317 | Replicon | chromosome |
Accession | NZ_LR216065 | ||
Organism | Streptococcus pneumoniae strain GPSC18 substr. ST13 isolate 55896440-41bd-11e5-998e-3c4a9275d6c6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | B1I7Q0 |
Locus tag | E0F40_RS08555 | Protein ID | WP_001132285.1 |
Coordinates | 1621138..1621317 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | E0F40_RS08550 | Protein ID | WP_000961810.1 |
Coordinates | 1620649..1621101 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0F40_RS08530 | 1617498..1618532 | - | 1035 | WP_000747915.1 | ATP-binding protein | - |
E0F40_RS08535 | 1618642..1618800 | - | 159 | WP_000401986.1 | 7,8-dihydro-8-oxoguanine-triphosphatase | - |
E0F40_RS08540 | 1618802..1619869 | - | 1068 | WP_000719723.1 | M50 family metallopeptidase | - |
E0F40_RS08545 | 1619888..1620358 | - | 471 | WP_000257084.1 | DUF3013 family protein | - |
E0F40_RS08550 | 1620649..1621101 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
E0F40_RS08555 | 1621138..1621317 | - | 180 | WP_001132285.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
E0F40_RS08560 | 1621454..1621633 | - | 180 | WP_001048906.1 | hypothetical protein | - |
E0F40_RS08570 | 1621798..1622037 | - | 240 | WP_000818078.1 | hypothetical protein | - |
E0F40_RS08580 | 1622307..1623578 | + | 1272 | WP_001113218.1 | replication-associated recombination protein A | - |
E0F40_RS08590 | 1624125..1625444 | - | 1320 | WP_000502558.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.01 Da Isoelectric Point: 11.2964
>T288343 WP_001132285.1 NZ_LR216065:c1621317-1621138 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT288343 WP_000961810.1 NZ_LR216065:c1621101-1620649 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9HEZ5 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5YRZ | |
AlphaFold DB | G0IC64 |