Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1610969..1611631 | Replicon | chromosome |
Accession | NZ_LR216064 | ||
Organism | Streptococcus pneumoniae strain GPSC13 substr. ST473 isolate 569492b0-41bd-11e5-998e-3c4a9275d6c6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | E0F31_RS08580 | Protein ID | WP_000192221.1 |
Coordinates | 1611458..1611631 (-) | Length | 58 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | E0F31_RS08575 | Protein ID | WP_000961810.1 |
Coordinates | 1610969..1611421 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0F31_RS08555 | 1607818..1608852 | - | 1035 | WP_000747915.1 | ATP-binding protein | - |
E0F31_RS08560 | 1608962..1609120 | - | 159 | WP_000418159.1 | 7,8-dihydro-8-oxoguanine-triphosphatase | - |
E0F31_RS08565 | 1609101..1610189 | - | 1089 | WP_000719700.1 | M50 family metallopeptidase | - |
E0F31_RS08570 | 1610208..1610678 | - | 471 | WP_000257089.1 | DUF3013 family protein | - |
E0F31_RS08575 | 1610969..1611421 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
E0F31_RS08580 | 1611458..1611631 | - | 174 | WP_000192221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
E0F31_RS08585 | 1611774..1611953 | - | 180 | WP_001809903.1 | hypothetical protein | - |
E0F31_RS08595 | 1612118..1612357 | - | 240 | WP_000818078.1 | hypothetical protein | - |
E0F31_RS08605 | 1612627..1613898 | + | 1272 | WP_001113211.1 | replication-associated recombination protein A | - |
E0F31_RS08615 | 1614442..1615761 | - | 1320 | WP_054374557.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6368.47 Da Isoelectric Point: 10.8214
>T288339 WP_000192221.1 NZ_LR216064:c1611631-1611458 [Streptococcus pneumoniae]
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
MTQKEMVKLLTAHGWIKTRGGKGSHIKIEKQGERPITILHGELNKYTERGIGKQAGL
Download Length: 174 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT288339 WP_000961810.1 NZ_LR216064:c1611421-1610969 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|