Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1608448..1609116 | Replicon | chromosome |
Accession | NZ_LR216050 | ||
Organism | Streptococcus pneumoniae strain GPSC10 substr. ST2013 isolate GPS_US_PATH396-sc-2296505 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0B7M7X4 |
Locus tag | E0F32_RS08630 | Protein ID | WP_001132284.1 |
Coordinates | 1608937..1609116 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | E0F32_RS08625 | Protein ID | WP_000961810.1 |
Coordinates | 1608448..1608900 (-) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0F32_RS08595 | 1603868..1604611 | - | 744 | WP_001188201.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
E0F32_RS08600 | 1604613..1605563 | - | 951 | WP_024477875.1 | 50S ribosomal protein L11 methyltransferase | - |
E0F32_RS08605 | 1605701..1606174 | - | 474 | WP_000631889.1 | GNAT family N-acetyltransferase | - |
E0F32_RS08610 | 1606171..1606599 | - | 429 | WP_024477876.1 | NUDIX hydrolase | - |
E0F32_RS08615 | 1606580..1607668 | - | 1089 | WP_162499228.1 | M50 family metallopeptidase | - |
E0F32_RS08620 | 1607687..1608157 | - | 471 | WP_000257084.1 | DUF3013 family protein | - |
E0F32_RS08625 | 1608448..1608900 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
E0F32_RS08630 | 1608937..1609116 | - | 180 | WP_001132284.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
E0F32_RS08635 | 1609253..1609501 | - | 249 | WP_000797240.1 | hypothetical protein | - |
E0F32_RS08640 | 1609491..1609706 | - | 216 | WP_075329187.1 | hypothetical protein | - |
E0F32_RS08645 | 1610004..1611275 | + | 1272 | WP_001113213.1 | replication-associated recombination protein A | - |
E0F32_RS08655 | 1611823..1613142 | - | 1320 | WP_024477878.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.95 Da Isoelectric Point: 11.0174
>T288333 WP_001132284.1 NZ_LR216050:c1609116-1608937 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT288333 WP_000961810.1 NZ_LR216050:c1608900-1608448 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B7M7X4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0IC64 |