Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 32884..33476 | Replicon | chromosome |
Accession | NZ_LR215980 | ||
Organism | Paraprevotella xylaniphila YIT 11841 isolate Paraprevotella xylaniphila 82A6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | E0E47_RS00210 | Protein ID | WP_130892520.1 |
Coordinates | 32884..33135 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | E0E47_RS00215 | Protein ID | WP_130892521.1 |
Coordinates | 33132..33476 (+) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E47_RS00175 | 29021..29533 | - | 513 | WP_130892514.1 | hypothetical protein | - |
E0E47_RS00180 | 29533..30273 | - | 741 | WP_130892515.1 | ParB/RepB/Spo0J family partition protein | - |
E0E47_RS00185 | 30498..31172 | - | 675 | WP_130892516.1 | phosphoadenosine phosphosulfate reductase family protein | - |
E0E47_RS00190 | 31353..31712 | - | 360 | WP_130892517.1 | ASCH domain-containing protein | - |
E0E47_RS00200 | 32019..32351 | - | 333 | WP_130892518.1 | DUF2693 domain-containing protein | - |
E0E47_RS00205 | 32541..32831 | + | 291 | WP_130892519.1 | helix-turn-helix transcriptional regulator | - |
E0E47_RS00210 | 32884..33135 | + | 252 | WP_130892520.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
E0E47_RS00215 | 33132..33476 | + | 345 | WP_130892521.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
E0E47_RS00220 | 33572..34087 | + | 516 | WP_130892522.1 | hypothetical protein | - |
E0E47_RS00225 | 34132..34707 | + | 576 | WP_130892523.1 | ORF6N domain-containing protein | - |
E0E47_RS00230 | 34748..35947 | - | 1200 | WP_130892524.1 | phage integrase SAM-like domain-containing protein | - |
E0E47_RS00240 | 36388..37266 | - | 879 | WP_130892525.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
E0E47_RS00245 | 37280..38389 | - | 1110 | WP_130892526.1 | AhpC/TSA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9446.00 Da Isoelectric Point: 10.6053
>T288327 WP_130892520.1 NZ_LR215980:32884-33135 [Paraprevotella xylaniphila YIT 11841]
MGTKEKLIERFKSQPKDFSWDELVRLFSIFGYEISNKGKTSGSRVIFAKGGSSYTAHKPHPGSIVKGYVMKQVFEFLTKN
KLI
MGTKEKLIERFKSQPKDFSWDELVRLFSIFGYEISNKGKTSGSRVIFAKGGSSYTAHKPHPGSIVKGYVMKQVFEFLTKN
KLI
Download Length: 252 bp
Antitoxin
Download Length: 115 a.a. Molecular weight: 12550.35 Da Isoelectric Point: 4.8604
>AT288327 WP_130892521.1 NZ_LR215980:33132-33476 [Paraprevotella xylaniphila YIT 11841]
MKTLNYKGYVGSIEISDEDNCLFGKVLDLPKDTVISYEGETVSDLKEDFKGAVDDYIAYCKEAGITPRKSYSGSLNIRIS
PEVHNKIAILAQQAGISINAFIKKAIENQIATML
MKTLNYKGYVGSIEISDEDNCLFGKVLDLPKDTVISYEGETVSDLKEDFKGAVDDYIAYCKEAGITPRKSYSGSLNIRIS
PEVHNKIAILAQQAGISINAFIKKAIENQIATML
Download Length: 345 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|