Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2395393..2396027 | Replicon | chromosome |
Accession | NZ_LR215729 | ||
Organism | Pseudomonas marincola strain YSy11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PMYSY11_RS11135 | Protein ID | WP_150549226.1 |
Coordinates | 2395393..2395797 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L1LS63 |
Locus tag | PMYSY11_RS11140 | Protein ID | WP_003285520.1 |
Coordinates | 2395797..2396027 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMYSY11_RS11105 | 2391156..2391293 | - | 138 | WP_172970686.1 | hypothetical protein | - |
PMYSY11_RS11110 | 2391591..2393000 | + | 1410 | WP_150549223.1 | site-specific integrase | - |
PMYSY11_RS11115 | 2392994..2393287 | - | 294 | WP_150549224.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PMYSY11_RS11120 | 2393275..2393547 | - | 273 | WP_116801393.1 | CopG family ribbon-helix-helix protein | - |
PMYSY11_RS11125 | 2393949..2394281 | + | 333 | WP_036992178.1 | hypothetical protein | - |
PMYSY11_RS11130 | 2394341..2395309 | + | 969 | WP_150549225.1 | DUF932 domain-containing protein | - |
PMYSY11_RS11135 | 2395393..2395797 | - | 405 | WP_150549226.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PMYSY11_RS11140 | 2395797..2396027 | - | 231 | WP_003285520.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PMYSY11_RS11145 | 2396184..2397188 | + | 1005 | WP_150549227.1 | YqaJ viral recombinase family protein | - |
PMYSY11_RS11150 | 2397280..2398230 | + | 951 | WP_150549228.1 | hydrolase or metal-binding protein | - |
PMYSY11_RS11155 | 2398202..2398699 | + | 498 | WP_150549229.1 | DNA repair protein RadC | - |
PMYSY11_RS11160 | 2398710..2398892 | + | 183 | WP_059319052.1 | hypothetical protein | - |
PMYSY11_RS11165 | 2398993..2399979 | - | 987 | WP_150549230.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2389121..2399979 | 10858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14950.17 Da Isoelectric Point: 7.2774
>T288320 WP_150549226.1 NZ_LR215729:c2395797-2395393 [Pseudomonas marincola]
MLKYMLDTNICIFTIKNRPEQVREAFKRHSGQLSISTVTLMELIYGAEKSANPERNLADVEGFAARLEVLPYDAQAAAHS
GQLRAELARIGKPIGPYDQMIAGHARAQGLILVTNNLREFERVPGLRVEDWVSA
MLKYMLDTNICIFTIKNRPEQVREAFKRHSGQLSISTVTLMELIYGAEKSANPERNLADVEGFAARLEVLPYDAQAAAHS
GQLRAELARIGKPIGPYDQMIAGHARAQGLILVTNNLREFERVPGLRVEDWVSA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|