Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4074238..4074892 | Replicon | chromosome |
Accession | NZ_LR213458 | ||
Organism | Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | E0E38_RS20625 | Protein ID | WP_000244777.1 |
Coordinates | 4074238..4074645 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | E0E38_RS20630 | Protein ID | WP_000354046.1 |
Coordinates | 4074626..4074892 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E38_RS20605 (4070195) | 4070195..4071928 | - | 1734 | WP_000813167.1 | single-stranded-DNA-specific exonuclease RecJ | - |
E0E38_RS20610 (4071934) | 4071934..4072644 | - | 711 | WP_000715206.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
E0E38_RS20615 (4072669) | 4072669..4073565 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
E0E38_RS20620 (4073677) | 4073677..4074198 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
E0E38_RS20625 (4074238) | 4074238..4074645 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
E0E38_RS20630 (4074626) | 4074626..4074892 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
E0E38_RS20635 (4075135) | 4075135..4076115 | + | 981 | WP_000886060.1 | tRNA-modifying protein YgfZ | - |
E0E38_RS20640 (4076311) | 4076311..4076970 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
E0E38_RS20645 (4077134) | 4077134..4077445 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
E0E38_RS20650 (4077490) | 4077490..4078923 | + | 1434 | WP_005137189.1 | 6-phospho-beta-glucosidase BglA | - |
E0E38_RS20655 (4078980) | 4078980..4079723 | - | 744 | WP_000951937.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T288304 WP_000244777.1 NZ_LR213458:c4074645-4074238 [Shigella sonnei]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |