Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2619299..2619783 Replicon chromosome
Accession NZ_LR213458
Organism Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A377EAU1
Locus tag E0E38_RS13105 Protein ID WP_014334020.1
Coordinates 2619299..2619589 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A376K4R9
Locus tag E0E38_RS13110 Protein ID WP_005142544.1
Coordinates 2619589..2619783 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E38_RS13070 (2614370) 2614370..2614984 - 615 WP_000148710.1 Tat proofreading chaperone DmsD -
E0E38_RS13075 (2615027) 2615027..2615881 - 855 WP_000526502.1 dimethyl sulfoxide reductase anchor subunit family protein -
E0E38_RS13080 (2615883) 2615883..2616500 - 618 WP_000213029.1 dimethylsulfoxide reductase subunit B -
E0E38_RS13085 (2616511) 2616511..2617587 - 1077 Protein_2514 molybdopterin dinucleotide binding domain-containing protein -
E0E38_RS13090 (2617645) 2617645..2618342 + 698 WP_094096600.1 IS1-like element IS1A family transposase -
E0E38_RS13095 (2618490) 2618490..2618855 - 366 WP_024174355.1 hypothetical protein -
E0E38_RS13100 (2618867) 2618867..2619019 - 153 WP_000379558.1 DUF1391 family protein -
E0E38_RS13105 (2619299) 2619299..2619589 - 291 WP_014334020.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
E0E38_RS13110 (2619589) 2619589..2619783 - 195 WP_005142544.1 hypothetical protein Antitoxin
E0E38_RS13115 (2619803) 2619803..2620288 - 486 WP_053002468.1 helix-turn-helix domain-containing protein -
E0E38_RS13120 (2620415) 2620415..2620678 + 264 WP_001048456.1 helix-turn-helix transcriptional regulator -
E0E38_RS13125 (2620675) 2620675..2621100 + 426 WP_000693826.1 toxin YdaT family protein -
E0E38_RS13130 (2621172) 2621172..2622236 + 1065 WP_039063478.1 phage replisome organizer -
E0E38_RS13135 (2622243) 2622243..2622989 + 747 WP_000788740.1 ATP-binding protein -
E0E38_RS13140 (2623011) 2623011..2623736 + 726 WP_000450631.1 DUF1627 domain-containing protein -
E0E38_RS13145 (2623752) 2623752..2624174 + 423 WP_001151171.1 DUF977 family protein -
E0E38_RS13150 (2624232) 2624232..2624588 + 357 WP_005140877.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2618490..2643610 25120


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11062.93 Da        Isoelectric Point: 10.2013

>T288300 WP_014334020.1 NZ_LR213458:c2619589-2619299 [Shigella sonnei]
MLPVLWLPSARDDLRQIVAYIAKENPAAARRMKIRIETSVLPLTEHPYLYPPSERVLGLREIVTHPNYIILYRVTASSIE
VVNIVHSRRQYPGKNS

Download         Length: 291 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7097.98 Da        Isoelectric Point: 4.1759

>AT288300 WP_005142544.1 NZ_LR213458:c2619783-2619589 [Shigella sonnei]
MSTVLSPMVSEFETVEQENSYNEWLRAKVAASLADPRPAIPHDEVMAEMEQIIAQIAAATHRGE

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377EAU1

Antitoxin

Source ID Structure
AlphaFold DB A0A376K4R9

References