Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1475316..1475934 | Replicon | chromosome |
| Accession | NZ_LR213458 | ||
| Organism | Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | E0E38_RS07180 | Protein ID | WP_001291435.1 |
| Coordinates | 1475316..1475534 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0H8V4S8 |
| Locus tag | E0E38_RS07185 | Protein ID | WP_000344804.1 |
| Coordinates | 1475560..1475934 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E38_RS07145 (1470608) | 1470608..1471180 | + | 573 | WP_000779812.1 | YbaY family lipoprotein | - |
| E0E38_RS07150 (1471211) | 1471211..1471522 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| E0E38_RS07160 (1471901) | 1471901..1472254 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| E0E38_RS07165 (1472296) | 1472296..1473844 | - | 1549 | Protein_1377 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| E0E38_RS07170 (1474008) | 1474008..1474478 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| E0E38_RS07175 (1474594) | 1474594..1475145 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| E0E38_RS07180 (1475316) | 1475316..1475534 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| E0E38_RS07185 (1475560) | 1475560..1475934 | - | 375 | WP_000344804.1 | Hha toxicity modulator TomB | Antitoxin |
| E0E38_RS07190 (1476480) | 1476480..1479629 | - | 3150 | WP_001132464.1 | efflux RND transporter permease AcrB | - |
| E0E38_RS07195 (1479652) | 1479652..1480845 | - | 1194 | WP_011310152.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288295 WP_001291435.1 NZ_LR213458:c1475534-1475316 [Shigella sonnei]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14615.43 Da Isoelectric Point: 4.6232
>AT288295 WP_000344804.1 NZ_LR213458:c1475934-1475560 [Shigella sonnei]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIETFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIETFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H8V4S8 |