Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1439755..1440592 | Replicon | chromosome |
Accession | NZ_LR213458 | ||
Organism | Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | E0E38_RS07005 | Protein ID | WP_000227784.1 |
Coordinates | 1439755..1440297 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | E0E38_RS07010 | Protein ID | WP_001297137.1 |
Coordinates | 1440281..1440592 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E38_RS06975 (1434819) | 1434819..1435310 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
E0E38_RS06980 (1435438) | 1435438..1436802 | - | 1365 | WP_001000971.1 | MFS transporter | - |
E0E38_RS06985 (1436921) | 1436921..1437618 | + | 698 | WP_237158184.1 | IS1-like element IS1A family transposase | - |
E0E38_RS06990 (1437987) | 1437987..1438385 | + | 399 | Protein_1342 | SEL1-like repeat protein | - |
E0E38_RS07000 (1439133) | 1439133..1439699 | + | 567 | Protein_1344 | SEL1-like repeat protein | - |
E0E38_RS07005 (1439755) | 1439755..1440297 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
E0E38_RS07010 (1440281) | 1440281..1440592 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
E0E38_RS07015 (1440777) | 1440777..1441667 | - | 891 | WP_000971327.1 | heme o synthase | - |
E0E38_RS07020 (1441679) | 1441679..1442008 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
E0E38_RS07025 (1442008) | 1442008..1442622 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
E0E38_RS07030 (1442612) | 1442612..1444603 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
E0E38_RS07035 (1444625) | 1444625..1445572 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T288294 WP_000227784.1 NZ_LR213458:c1440297-1439755 [Shigella sonnei]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|