Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 217645..218204 Replicon plasmid 2
Accession NZ_LR213456
Organism Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag E0E35_RS25220 Protein ID WP_000421262.1
Coordinates 217645..217920 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A822PWA0
Locus tag E0E35_RS25225 Protein ID WP_011114774.1
Coordinates 217920..218204 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E35_RS25195 214652..214957 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
E0E35_RS25200 214959..215177 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
E0E35_RS25205 215713..216666 - 954 Protein_251 IS66 family transposase -
E0E35_RS25210 216722..217419 + 698 WP_227804301.1 IS1 family transposase -
E0E35_RS25220 217645..217920 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
E0E35_RS25225 217920..218204 - 285 WP_011114774.1 ribbon-helix-helix domain-containing protein Antitoxin
E0E35_RS25235 218656..218907 + 252 WP_001381727.1 transporter -
E0E35_RS25240 218957..219166 + 210 Protein_256 peptidoglycan-binding protein -
E0E35_RS25245 219266..219451 - 186 Protein_257 ATP-binding protein -
E0E35_RS25250 219640..221241 - 1602 WP_011069533.1 IS66-like element ISSfl3 family transposase -
E0E35_RS25255 221261..221608 - 348 WP_000631708.1 IS66 family insertion sequence element accessory protein TnpB -
E0E35_RS25260 221605..222279 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH7.8 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI 1..234171 234171
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 205558..229953 24395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T288284 WP_000421262.1 NZ_LR213456:c217920-217645 [Shigella flexneri]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10529.97 Da        Isoelectric Point: 6.2150

>AT288284 WP_011114774.1 NZ_LR213456:c218204-217920 [Shigella flexneri]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHLLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure
AlphaFold DB A0A822PWA0

References