Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 119121..119896 Replicon plasmid 2
Accession NZ_LR213456
Organism Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)


Gene name tacT Uniprot ID Q7BEG9
Locus tag E0E35_RS24565 Protein ID WP_000405245.1
Coordinates 119414..119896 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q7BEG8
Locus tag E0E35_RS24560 Protein ID WP_010921625.1
Coordinates 119121..119423 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E35_RS24525 114463..115082 - 620 Protein_126 IS1 family transposase -
E0E35_RS24530 115486..116940 + 1455 WP_000701108.1 type 3 secretion system effector OspC2 -
E0E35_RS25990 117089..117217 - 129 Protein_128 IS5/IS1182 family transposase -
E0E35_RS24550 118577..118849 - 273 WP_000019158.1 hypothetical protein -
E0E35_RS24560 119121..119423 + 303 WP_010921625.1 DUF1778 domain-containing protein Antitoxin
E0E35_RS24565 119414..119896 + 483 WP_000405245.1 GNAT family N-acetyltransferase Toxin
E0E35_RS24570 119964..120487 + 524 Protein_133 IS3-like element ISSfl11 family transposase -
E0E35_RS24575 120530..121738 - 1209 Protein_134 IS3 family transposase -
E0E35_RS24580 121790..123481 - 1692 Protein_135 NEL-type E3 ubiquitin ligase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH4.5 / ipaH7.8 / ospC2 / ipaH7.8 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI 1..234171 234171
- inside IScluster/Tn - ospC2 / ipaH7.8 / ipaH2.5 / ospE2 109834..132591 22757


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(29-149)

Antitoxin

Vibrio phage ICP1, Orf50

(19-94)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17750.52 Da        Isoelectric Point: 7.0382

>T288281 WP_000405245.1 NZ_LR213456:119414-119896 [Shigella flexneri]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEDTLRIVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11689.28 Da        Isoelectric Point: 4.9167

>AT288281 WP_010921625.1 NZ_LR213456:119121-119423 [Shigella flexneri]
MEVFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRTDFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q7BEG9

Antitoxin

Source ID Structure
AlphaFold DB Q7BEG8

References