Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2839620..2840415 Replicon chromosome
Accession NZ_LR213455
Organism Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)


Gene name yeeV Uniprot ID Q93EZ7
Locus tag E0E35_RS14835 Protein ID WP_000854917.1
Coordinates 2839620..2839994 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID D2ACA1
Locus tag E0E35_RS14840 Protein ID WP_001280958.1
Coordinates 2840041..2840415 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E35_RS14800 (2835229) 2835229..2836167 - 939 Protein_2818 glyoxylate/hydroxypyruvate reductase GhrA -
E0E35_RS14810 (2836639) 2836639..2836920 - 282 Protein_2819 DUF4942 domain-containing protein -
E0E35_RS14815 (2837202) 2837202..2838206 - 1005 WP_001179707.1 IS110-like element ISSfl8 family transposase -
E0E35_RS14820 (2838278) 2838278..2838838 - 561 Protein_2821 DUF4942 domain-containing protein -
E0E35_RS14825 (2838923) 2838923..2839120 - 198 WP_000839282.1 DUF957 domain-containing protein -
E0E35_RS14830 (2839132) 2839132..2839623 - 492 WP_000976828.1 DUF5983 family protein -
E0E35_RS14835 (2839620) 2839620..2839994 - 375 WP_000854917.1 TA system toxin CbtA family protein Toxin
E0E35_RS14840 (2840041) 2840041..2840415 - 375 WP_001280958.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
E0E35_RS14845 (2840578) 2840578..2840799 - 222 WP_001220314.1 DUF987 domain-containing protein -
E0E35_RS14850 (2840862) 2840862..2841338 - 477 WP_005011624.1 RadC family protein -
E0E35_RS14855 (2841354) 2841354..2841827 - 474 WP_005011597.1 antirestriction protein -
E0E35_RS14865 (2842169) 2842169..2842987 - 819 WP_001234651.1 DUF932 domain-containing protein -
E0E35_RS14875 (2843105) 2843105..2843300 - 196 Protein_2830 DUF905 family protein -
E0E35_RS14880 (2843371) 2843371..2843589 - 219 Protein_2831 autotransporter domain-containing protein -
E0E35_RS14885 (2843784) 2843784..2845325 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2837202..2838206 1004


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14145.22 Da        Isoelectric Point: 7.7761

>T288276 WP_000854917.1 NZ_LR213455:c2839994-2839620 [Shigella flexneri]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13793.62 Da        Isoelectric Point: 6.4651

>AT288276 WP_001280958.1 NZ_LR213455:c2840415-2840041 [Shigella flexneri]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93EZ7

Antitoxin

Source ID Structure
AlphaFold DB A0A0K4PAV2

References