Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2315245..2315771 | Replicon | chromosome |
| Accession | NZ_LR213455 | ||
| Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | E0E35_RS11895 | Protein ID | WP_000323025.1 |
| Coordinates | 2315484..2315771 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | E0E35_RS11890 | Protein ID | WP_000534858.1 |
| Coordinates | 2315245..2315484 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E35_RS11865 (2310893) | 2310893..2311096 | + | 204 | WP_000214712.1 | putative selenium delivery protein YdfZ | - |
| E0E35_RS11870 (2311132) | 2311132..2312592 | - | 1461 | WP_000527804.1 | mannitol dehydrogenase family protein | - |
| E0E35_RS11875 (2312681) | 2312681..2313700 | - | 1020 | Protein_2251 | MHS family MFS transporter YdfJ | - |
| E0E35_RS11880 (2313762) | 2313762..2314918 | + | 1157 | Protein_2252 | IS3-like element IS600 family transposase | - |
| E0E35_RS11885 (2314915) | 2314915..2315220 | - | 306 | WP_071818640.1 | hypothetical protein | - |
| E0E35_RS11890 (2315245) | 2315245..2315484 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| E0E35_RS11895 (2315484) | 2315484..2315771 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| E0E35_RS11900 (2315843) | 2315843..2315998 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| E0E35_RS11905 (2316216) | 2316216..2316467 | + | 252 | WP_000980987.1 | protein Rem | - |
| E0E35_RS11910 (2316534) | 2316534..2316812 | + | 279 | Protein_2258 | hypothetical protein | - |
| E0E35_RS11915 (2316814) | 2316814..2317863 | + | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
| E0E35_RS11920 (2317876) | 2317876..2318232 | + | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E0E35_RS11925 (2318247) | 2318247..2319068 | + | 822 | WP_000762882.1 | antitermination protein | - |
| E0E35_RS11945 (2319989) | 2319989..2320097 | + | 109 | Protein_2262 | DUF3927 family protein | - |
| E0E35_RS11950 (2320378) | 2320378..2320713 | - | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2304727..2329030 | 24303 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T288274 WP_000323025.1 NZ_LR213455:2315484-2315771 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|