Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 921292..921946 | Replicon | chromosome |
Accession | NZ_LR213455 | ||
Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | E0E35_RS04650 | Protein ID | WP_000244767.1 |
Coordinates | 921292..921699 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q0T100 |
Locus tag | E0E35_RS04655 | Protein ID | WP_000354044.1 |
Coordinates | 921680..921946 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E35_RS04630 (917249) | 917249..918982 | - | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
E0E35_RS04635 (918988) | 918988..919698 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
E0E35_RS04640 (919723) | 919723..920619 | - | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
E0E35_RS04645 (920731) | 920731..921252 | + | 522 | WP_001055867.1 | flavodoxin FldB | - |
E0E35_RS04650 (921292) | 921292..921699 | - | 408 | WP_000244767.1 | protein YgfX | Toxin |
E0E35_RS04655 (921680) | 921680..921946 | - | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
E0E35_RS04660 (922189) | 922189..923169 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
E0E35_RS04665 (923365) | 923365..924024 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
E0E35_RS04670 (924188) | 924188..924498 | - | 311 | Protein_894 | N(4)-acetylcytidine aminohydrolase | - |
E0E35_RS04675 (924543) | 924543..925976 | + | 1434 | WP_005051722.1 | 6-phospho-beta-glucosidase BglA | - |
E0E35_RS04680 (926033) | 926033..926776 | - | 744 | WP_000951957.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T288268 WP_000244767.1 NZ_LR213455:c921699-921292 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU2 |