Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 869742..870543 | Replicon | chromosome |
| Accession | NZ_LR213455 | ||
| Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D3GUT5 |
| Locus tag | E0E35_RS04365 | Protein ID | WP_001094430.1 |
| Coordinates | 869742..870119 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D3GUT4 |
| Locus tag | E0E35_RS04370 | Protein ID | WP_001285620.1 |
| Coordinates | 870166..870543 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E35_RS04335 (864955) | 864955..865422 | + | 468 | WP_011069513.1 | prepilin peptidase | - |
| E0E35_RS04345 (867091) | 867091..867336 | - | 246 | WP_000875412.1 | hypothetical protein | - |
| E0E35_RS04350 (868113) | 868113..868955 | - | 843 | WP_001290187.1 | DUF4942 domain-containing protein | - |
| E0E35_RS04355 (869040) | 869040..869237 | - | 198 | WP_000772029.1 | DUF957 domain-containing protein | - |
| E0E35_RS04360 (869257) | 869257..869745 | - | 489 | WP_000761715.1 | DUF5983 family protein | - |
| E0E35_RS04365 (869742) | 869742..870119 | - | 378 | WP_001094430.1 | TA system toxin CbtA family protein | Toxin |
| E0E35_RS04370 (870166) | 870166..870543 | - | 378 | WP_001285620.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| E0E35_RS04375 (870623) | 870623..870844 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| E0E35_RS04380 (870931) | 870931..871407 | - | 477 | WP_128570583.1 | RadC family protein | - |
| E0E35_RS04385 (871423) | 871423..871896 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| E0E35_RS04395 (872238) | 872238..873056 | - | 819 | WP_001177758.1 | DUF932 domain-containing protein | - |
| E0E35_RS26565 (873235) | 873235..873324 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| E0E35_RS04410 (873467) | 873467..873922 | - | 456 | WP_005051844.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13971.82 Da Isoelectric Point: 6.8608
>T288267 WP_001094430.1 NZ_LR213455:c870119-869742 [Shigella flexneri]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13698.52 Da Isoelectric Point: 5.9505
>AT288267 WP_001285620.1 NZ_LR213455:c870543-870166 [Shigella flexneri]
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y6M7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2INW | |
| AlphaFold DB | A0A0E0Y522 |