Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2685755..2686550 | Replicon | chromosome |
| Accession | NZ_LR213452 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q93EZ7 |
| Locus tag | E0E33_RS13940 | Protein ID | WP_000854917.1 |
| Coordinates | 2685755..2686129 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D2ACA1 |
| Locus tag | E0E33_RS13945 | Protein ID | WP_001280958.1 |
| Coordinates | 2686176..2686550 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS13905 | 2681364..2682302 | - | 939 | Protein_2654 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| E0E33_RS13915 | 2682774..2683055 | - | 282 | Protein_2655 | DUF4942 domain-containing protein | - |
| E0E33_RS13920 | 2683337..2684341 | - | 1005 | WP_001179707.1 | IS110-like element ISSfl8 family transposase | - |
| E0E33_RS13925 | 2684413..2684973 | - | 561 | Protein_2657 | DUF4942 domain-containing protein | - |
| E0E33_RS13930 | 2685058..2685255 | - | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| E0E33_RS13935 | 2685267..2685758 | - | 492 | WP_130862204.1 | hypothetical protein | - |
| E0E33_RS13940 | 2685755..2686129 | - | 375 | WP_000854917.1 | TA system toxin CbtA family protein | Toxin |
| E0E33_RS13945 | 2686176..2686550 | - | 375 | WP_001280958.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| E0E33_RS13950 | 2686713..2686934 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| E0E33_RS13955 | 2686997..2687473 | - | 477 | WP_005011624.1 | RadC family protein | - |
| E0E33_RS13960 | 2687489..2687962 | - | 474 | WP_005011597.1 | antirestriction protein | - |
| E0E33_RS13970 | 2688304..2689125 | - | 822 | WP_001234584.1 | DUF945 domain-containing protein | - |
| E0E33_RS13975 | 2689225..2689398 | - | 174 | WP_000088744.1 | DUF905 family protein | - |
| E0E33_RS13980 | 2689518..2689967 | - | 450 | WP_077515298.1 | hypothetical protein | - |
| E0E33_RS13985 | 2689964..2690661 | - | 698 | Protein_2668 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2683337..2684341 | 1004 | |
| - | flank | IS/Tn | - | - | 2689964..2690467 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14145.22 Da Isoelectric Point: 7.7761
>T288251 WP_000854917.1 NZ_LR213452:c2686129-2685755 [Shigella flexneri]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13793.62 Da Isoelectric Point: 6.4651
>AT288251 WP_001280958.1 NZ_LR213452:c2686550-2686176 [Shigella flexneri]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q93EZ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K4PAV2 |