Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 852112..852766 | Replicon | chromosome |
Accession | NZ_LR213452 | ||
Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | E0E33_RS04320 | Protein ID | WP_000244767.1 |
Coordinates | 852359..852766 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | Q0T100 |
Locus tag | E0E33_RS04315 | Protein ID | WP_000354044.1 |
Coordinates | 852112..852378 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E33_RS04290 | 847283..848025 | + | 743 | Protein_828 | SDR family oxidoreductase | - |
E0E33_RS04295 | 848082..849515 | - | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
E0E33_RS04300 | 849560..849870 | + | 311 | Protein_830 | ASCH domain-containing protein | - |
E0E33_RS04305 | 850034..850693 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
E0E33_RS04310 | 850889..851869 | - | 981 | WP_000886065.1 | tRNA-modifying protein YgfZ | - |
E0E33_RS04315 | 852112..852378 | + | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
E0E33_RS04320 | 852359..852766 | + | 408 | WP_000244767.1 | protein YgfX | Toxin |
E0E33_RS04325 | 852806..853327 | - | 522 | WP_001055867.1 | flavodoxin FldB | - |
E0E33_RS04330 | 853439..854335 | + | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
E0E33_RS04335 | 854360..855070 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
E0E33_RS04340 | 855076..856809 | + | 1734 | WP_130862165.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T288243 WP_000244767.1 NZ_LR213452:852359-852766 [Shigella flexneri]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU2 |