Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 427251..427822 | Replicon | chromosome |
Accession | NZ_LR135782 | ||
Organism | Enterococcus faecium isolate E4239 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A828ZXV4 |
Locus tag | EQB67_RS02225 | Protein ID | WP_002302307.1 |
Coordinates | 427481..427822 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | EQB67_RS02220 | Protein ID | WP_002323011.1 |
Coordinates | 427251..427481 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB67_RS02180 | 422728..424059 | + | 1332 | WP_002346495.1 | FAD-dependent oxidoreductase | - |
EQB67_RS02185 | 424081..424707 | + | 627 | WP_002346494.1 | cysteine hydrolase | - |
EQB67_RS02190 | 424900..425481 | + | 582 | WP_002300332.1 | TetR/AcrR family transcriptional regulator | - |
EQB67_RS02205 | 425845..426420 | + | 576 | WP_002302305.1 | SOS response-associated peptidase family protein | - |
EQB67_RS02210 | 426625..426963 | - | 339 | WP_002286804.1 | hypothetical protein | - |
EQB67_RS02220 | 427251..427481 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
EQB67_RS02225 | 427481..427822 | + | 342 | WP_002302307.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB67_RS02235 | 430288..432792 | + | 2505 | WP_002323736.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13288.65 Da Isoelectric Point: 9.9044
>T288236 WP_002302307.1 NZ_LR135782:427481-427822 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZXV4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |