Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 37642..38779 | Replicon | plasmid 4 |
Accession | NZ_LR135491 | ||
Organism | Enterococcus faecium isolate E8414 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | EQB57_RS18030 | Protein ID | WP_077495093.1 |
Coordinates | 37642..38505 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | A0A7U7LLF6 |
Locus tag | EQB57_RS18035 | Protein ID | WP_031644662.1 |
Coordinates | 38507..38779 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB57_RS18000 | 33095..33712 | - | 618 | WP_099124473.1 | FtsX-like permease family protein | - |
EQB57_RS18005 | 33716..34396 | - | 681 | WP_060854029.1 | IS6-like element IS1216 family transposase | - |
EQB57_RS18010 | 34543..34626 | + | 84 | WP_001860874.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
EQB57_RS18015 | 34751..35488 | + | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
EQB57_RS18020 | 35792..36196 | + | 405 | WP_002287522.1 | IS200/IS605-like element ISEfa4 family transposase | - |
EQB57_RS18025 | 36213..37361 | + | 1149 | WP_002287525.1 | IS200/IS605 family element transposase accessory protein TnpB | - |
EQB57_RS18030 | 37642..38505 | - | 864 | WP_077495093.1 | zeta toxin family protein | Toxin |
EQB57_RS18035 | 38507..38779 | - | 273 | WP_031644662.1 | antitoxin | Antitoxin |
EQB57_RS18040 | 38797..39006 | - | 210 | WP_000527317.1 | peptide-binding protein | - |
EQB57_RS18045 | 39083..39979 | - | 897 | WP_099119832.1 | ParA family protein | - |
EQB57_RS18050 | 40082..41569 | - | 1488 | WP_077495095.1 | type IA DNA topoisomerase | - |
EQB57_RS18055 | 41760..42699 | - | 940 | WP_127822056.1 | IS1380-like element ISSsu5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(6)-Ia / VanHAX / erm(B) | - | 1..42699 | 42699 | |
- | inside | IScluster/Tn | erm(B) | - | 33716..42692 | 8976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32489.07 Da Isoelectric Point: 8.2810
>T288234 WP_077495093.1 NZ_LR135491:c38505-37642 [Enterococcus faecium]
MANIVNFTDKQFENRLRDNIEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIYEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKSYETKMYVMAVPKIESYLGTIERYE
TMFSDEPLTARATPKQAHDIVVKNLPINLDKLHKTGLFSDIRLYNRSGVKLYSSSETPSISPKETLERELNRKLSGKEIQ
PTLERVEQKMIQNKHQEAPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLRDNIEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIYEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKSYETKMYVMAVPKIESYLGTIERYE
TMFSDEPLTARATPKQAHDIVVKNLPINLDKLHKTGLFSDIRLYNRSGVKLYSSSETPSISPKETLERELNRKLSGKEIQ
PTLERVEQKMIQNKHQEAPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|