Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 2790..3898 | Replicon | plasmid 4 |
Accession | NZ_LR135491 | ||
Organism | Enterococcus faecium isolate E8414 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | EQB57_RS17830 | Protein ID | WP_000233000.1 |
Coordinates | 2790..3659 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | EQB57_RS17835 | Protein ID | WP_000205227.1 |
Coordinates | 3674..3898 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB57_RS17810 | 1..380 | - | 380 | WP_197724957.1 | transposase | - |
EQB57_RS17815 | 608..1135 | - | 528 | WP_002294507.1 | adenine phosphoribosyltransferase | - |
EQB57_RS17820 | 1179..2042 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
EQB57_RS17825 | 2075..2809 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
EQB57_RS17830 | 2790..3659 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
EQB57_RS17835 | 3674..3898 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EQB57_RS17840 | 4041..5603 | - | 1563 | WP_000136908.1 | recombinase family protein | - |
EQB57_RS17845 | 5605..6021 | - | 417 | WP_000323438.1 | recombinase | - |
EQB57_RS17850 | 6022..6318 | - | 297 | WP_002360685.1 | hypothetical protein | - |
EQB57_RS17855 | 6830..7507 | - | 678 | Protein_9 | DNA topoisomerase | - |
EQB57_RS17860 | 7523..8125 | - | 603 | WP_001062586.1 | recombinase family protein | - |
EQB57_RS18450 | 8139..8309 | - | 171 | WP_000713595.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(6)-Ia / VanHAX / erm(B) | - | 1..42699 | 42699 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T288233 WP_000233000.1 NZ_LR135491:c3659-2790 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|