Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 46514..47121 | Replicon | plasmid 2 |
| Accession | NZ_LR135489 | ||
| Organism | Enterococcus faecium isolate E8414 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | E3USU0 |
| Locus tag | EQB57_RS15935 | Protein ID | WP_002321032.1 |
| Coordinates | 46771..47121 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A829F3C0 |
| Locus tag | EQB57_RS15930 | Protein ID | WP_002287514.1 |
| Coordinates | 46514..46777 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB57_RS15885 | 41550..42449 | + | 900 | WP_010733696.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| EQB57_RS15890 | 42452..42949 | + | 498 | WP_048946612.1 | single-stranded DNA-binding protein | - |
| EQB57_RS15895 | 43315..43575 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| EQB57_RS15900 | 44020..44226 | + | 207 | WP_002325537.1 | hypothetical protein | - |
| EQB57_RS15905 | 44274..44477 | + | 204 | WP_110300627.1 | hypothetical protein | - |
| EQB57_RS15910 | 44493..44930 | + | 438 | WP_002332738.1 | hypothetical protein | - |
| EQB57_RS15915 | 44923..45630 | + | 708 | WP_002332739.1 | hypothetical protein | - |
| EQB57_RS15925 | 46010..46189 | + | 180 | WP_002305761.1 | hypothetical protein | - |
| EQB57_RS15930 | 46514..46777 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
| EQB57_RS15935 | 46771..47121 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EQB57_RS15940 | 47145..47759 | - | 615 | WP_002318230.1 | recombinase family protein | - |
| EQB57_RS15945 | 48073..48495 | + | 423 | WP_002288787.1 | hypothetical protein | - |
| EQB57_RS15950 | 48505..48708 | + | 204 | WP_002299573.1 | hypothetical protein | - |
| EQB57_RS15955 | 48919..49503 | + | 585 | WP_002299575.1 | recombinase family protein | - |
| EQB57_RS15960 | 49787..50467 | - | 681 | WP_010861579.1 | IS6-like element IS1216 family transposase | - |
| EQB57_RS15965 | 50646..51608 | + | 963 | WP_002302077.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(2'')-Ia | - | 1..229675 | 229675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T288232 WP_002321032.1 NZ_LR135489:46771-47121 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F5H8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F3C0 |