Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 46514..47121 Replicon plasmid 2
Accession NZ_LR135489
Organism Enterococcus faecium isolate E8414

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB57_RS15935 Protein ID WP_002321032.1
Coordinates 46771..47121 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB57_RS15930 Protein ID WP_002287514.1
Coordinates 46514..46777 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB57_RS15885 41550..42449 + 900 WP_010733696.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB57_RS15890 42452..42949 + 498 WP_048946612.1 single-stranded DNA-binding protein -
EQB57_RS15895 43315..43575 + 261 WP_002296240.1 hypothetical protein -
EQB57_RS15900 44020..44226 + 207 WP_002325537.1 hypothetical protein -
EQB57_RS15905 44274..44477 + 204 WP_110300627.1 hypothetical protein -
EQB57_RS15910 44493..44930 + 438 WP_002332738.1 hypothetical protein -
EQB57_RS15915 44923..45630 + 708 WP_002332739.1 hypothetical protein -
EQB57_RS15925 46010..46189 + 180 WP_002305761.1 hypothetical protein -
EQB57_RS15930 46514..46777 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB57_RS15935 46771..47121 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB57_RS15940 47145..47759 - 615 WP_002318230.1 recombinase family protein -
EQB57_RS15945 48073..48495 + 423 WP_002288787.1 hypothetical protein -
EQB57_RS15950 48505..48708 + 204 WP_002299573.1 hypothetical protein -
EQB57_RS15955 48919..49503 + 585 WP_002299575.1 recombinase family protein -
EQB57_RS15960 49787..50467 - 681 WP_010861579.1 IS6-like element IS1216 family transposase -
EQB57_RS15965 50646..51608 + 963 WP_002302077.1 LacI family DNA-binding transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(2'')-Ia - 1..229675 229675


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288232 WP_002321032.1 NZ_LR135489:46771-47121 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288232 WP_002287514.1 NZ_LR135489:46514-46777 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References