Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 51400..51919 Replicon plasmid 3
Accession NZ_LR135484
Organism Enterococcus faecium isolate E4456

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EQB55_RS15220 Protein ID WP_000588503.1
Coordinates 51662..51919 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EQB55_RS15215 Protein ID WP_000388479.1
Coordinates 51400..51669 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB55_RS15170 46507..47415 + 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
EQB55_RS15175 47412..47954 + 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
EQB55_RS15180 48047..48841 + 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
EQB55_RS15190 49117..49230 + 114 Protein_55 HTH domain-containing protein -
EQB55_RS15195 49272..49952 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EQB55_RS15200 50014..50709 + 696 WP_002326819.1 hypothetical protein -
EQB55_RS15210 51090..51269 + 180 WP_001120991.1 hypothetical protein -
EQB55_RS15215 51400..51669 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EQB55_RS15220 51662..51919 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EQB55_RS15225 52378..53382 + 1005 WP_000455809.1 hypothetical protein -
EQB55_RS15230 53547..54161 - 615 WP_001261742.1 recombinase family protein -
EQB55_RS15235 54611..55936 + 1326 WP_000969590.1 Y-family DNA polymerase -
EQB55_RS15240 55929..56279 + 351 WP_000568378.1 hypothetical protein -
EQB55_RS15245 56276..56455 + 180 WP_001021554.1 hypothetical protein -
EQB55_RS15250 56591..56881 + 291 WP_000026576.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / erm(B) / ant(6)-Ia / aph(3')-III - 1..58698 58698


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288229 WP_000588503.1 NZ_LR135484:51662-51919 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288229 WP_000388479.1 NZ_LR135484:51400-51669 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References