Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 149703..150811 | Replicon | plasmid 2 |
Accession | NZ_LR135483 | ||
Organism | Enterococcus faecium isolate E4456 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | EQB55_RS14455 | Protein ID | WP_000233000.1 |
Coordinates | 149703..150572 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | EQB55_RS14460 | Protein ID | WP_000205227.1 |
Coordinates | 150587..150811 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB55_RS14430 | 144812..145783 | - | 972 | Protein_158 | type IA DNA topoisomerase | - |
EQB55_RS14435 | 145974..147293 | - | 1320 | WP_002338419.1 | IS1380-like element ISSsu5 family transposase | - |
EQB55_RS14440 | 147521..148048 | - | 528 | WP_002294507.1 | adenine phosphoribosyltransferase | - |
EQB55_RS14445 | 148092..148955 | - | 864 | WP_002294505.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
EQB55_RS14450 | 148988..149722 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
EQB55_RS14455 | 149703..150572 | - | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
EQB55_RS14460 | 150587..150811 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EQB55_RS14470 | 151249..152531 | + | 1283 | Protein_165 | ISL3 family transposase | - |
EQB55_RS14480 | 152840..153643 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
EQB55_RS14485 | 153697..155181 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T288228 WP_000233000.1 NZ_LR135483:c150572-149703 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|