Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 49442..50049 Replicon plasmid 2
Accession NZ_LR135476
Organism Enterococcus faecium isolate E8423

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag EQB52_RS14060 Protein ID WP_002321032.1
Coordinates 49699..50049 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag EQB52_RS14055 Protein ID WP_002287514.1
Coordinates 49442..49705 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EQB52_RS14005 44478..45377 + 900 WP_002322787.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EQB52_RS14010 45380..45865 + 486 WP_002296241.1 single-stranded DNA-binding protein -
EQB52_RS14015 46231..46491 + 261 WP_002296240.1 hypothetical protein -
EQB52_RS14025 46932..47138 + 207 WP_002296239.1 hypothetical protein -
EQB52_RS14030 47138..47389 + 252 WP_002296238.1 hypothetical protein -
EQB52_RS14035 47404..47841 + 438 WP_002296237.1 hypothetical protein -
EQB52_RS14040 47834..48541 + 708 WP_002353391.1 hypothetical protein -
EQB52_RS14050 48922..49101 + 180 WP_002305761.1 hypothetical protein -
EQB52_RS14055 49442..49705 + 264 WP_002287514.1 hypothetical protein Antitoxin
EQB52_RS14060 49699..50049 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EQB52_RS14065 50073..50687 - 615 WP_010729795.1 recombinase family protein -
EQB52_RS14070 51001..51423 + 423 WP_002288787.1 hypothetical protein -
EQB52_RS14075 51433..51636 + 204 WP_002299573.1 hypothetical protein -
EQB52_RS14080 51847..52431 + 585 WP_002299575.1 recombinase family protein -
EQB52_RS14085 52620..53300 - 681 WP_010861579.1 IS6-like element IS1216 family transposase -
EQB52_RS14090 53354..54064 - 711 WP_010729797.1 GntR family transcriptional regulator -
EQB52_RS14095 54048..54782 - 735 WP_010729798.1 GntR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..256660 256660


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T288222 WP_002321032.1 NZ_LR135476:49699-50049 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT288222 WP_002287514.1 NZ_LR135476:49442-49705 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References