Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 450961..451532 | Replicon | chromosome |
Accession | NZ_LR135474 | ||
Organism | Enterococcus faecium isolate E9101 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | EQB44_RS02360 | Protein ID | WP_002286801.1 |
Coordinates | 451191..451532 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | EQB44_RS02355 | Protein ID | WP_002323011.1 |
Coordinates | 450961..451191 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EQB44_RS02320 | 446441..447769 | + | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
EQB44_RS02325 | 447791..448417 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
EQB44_RS02330 | 448600..449181 | + | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
EQB44_RS02340 | 449546..450121 | + | 576 | WP_002327432.1 | SOS response-associated peptidase family protein | - |
EQB44_RS02345 | 450327..450701 | - | 375 | WP_158076077.1 | hypothetical protein | - |
EQB44_RS02355 | 450961..451191 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
EQB44_RS02360 | 451191..451532 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EQB44_RS02365 | 452382..452567 | + | 186 | WP_002304207.1 | hypothetical protein | - |
EQB44_RS02370 | 452837..453999 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
EQB44_RS12480 | 454247..454372 | + | 126 | WP_025478972.1 | LPXTG cell wall anchor domain-containing protein | - |
EQB44_RS02380 | 454446..455342 | + | 897 | WP_002327428.1 | class C sortase | - |
EQB44_RS02385 | 455523..456197 | + | 675 | WP_002291233.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T288219 WP_002286801.1 NZ_LR135474:451191-451532 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |