Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 4690..5827 | Replicon | plasmid 7 |
Accession | NZ_LR135449 | ||
Organism | Enterococcus faecium isolate E7114 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | Q54944 |
Locus tag | FSA55_RS16275 | Protein ID | WP_001284311.1 |
Coordinates | 4690..5553 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | FSA55_RS16280 | Protein ID | WP_000301765.1 |
Coordinates | 5555..5827 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FSA55_RS16240 | 1..945 | + | 945 | WP_002303559.1 | replication initiation protein | - |
FSA55_RS16245 | 966..1088 | + | 123 | WP_232043242.1 | HTH domain-containing protein | - |
FSA55_RS16250 | 1142..1822 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
FSA55_RS16255 | 2146..2940 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
FSA55_RS16260 | 3350..3433 | + | 84 | Protein_4 | MLS leader peptide | - |
FSA55_RS16265 | 3482..3565 | + | 84 | WP_031929417.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
FSA55_RS16270 | 3690..4427 | + | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
FSA55_RS16275 | 4690..5553 | - | 864 | WP_001284311.1 | zeta toxin family protein | Toxin |
FSA55_RS16280 | 5555..5827 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
FSA55_RS16285 | 5844..6059 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
FSA55_RS16290 | 6218..6898 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
FSA55_RS16295 | 6925..7416 | + | 492 | WP_232043243.1 | DUF536 domain-containing protein | - |
FSA55_RS16300 | 7431..7601 | + | 171 | WP_032491833.1 | hypothetical protein | - |
FSA55_RS16305 | 8056..8280 | + | 225 | WP_002363584.1 | class II bacteriocin | - |
FSA55_RS16310 | 8300..8587 | + | 288 | WP_002363589.1 | bacteriocin immunity protein | - |
FSA55_RS16315 | 9038..9405 | + | 368 | Protein_15 | MobC family plasmid mobilization relaxosome protein | - |
FSA55_RS16320 | 9387..10301 | + | 915 | WP_010782659.1 | relaxase/mobilization nuclease domain-containing protein | - |
FSA55_RS16325 | 10249..10539 | + | 291 | WP_074399882.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3')-III / erm(B) | - | 1..12078 | 12078 | |
- | inside | IScluster/Tn | aph(3')-III / erm(B) | - | 1136..6904 | 5768 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T288217 WP_001284311.1 NZ_LR135449:c5553-4690 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 1GVN | |
PDB | 3Q8X |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F0A3 |