Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 47379..47898 Replicon plasmid 3
Accession NZ_LR135445
Organism Enterococcus faecium isolate E7114

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag FSA55_RS15475 Protein ID WP_000588503.1
Coordinates 47379..47636 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag FSA55_RS15480 Protein ID WP_000388479.1
Coordinates 47629..47898 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FSA55_RS15450 42933..43136 - 204 WP_002299573.1 hypothetical protein -
FSA55_RS15455 43146..43568 - 423 WP_002303116.1 hypothetical protein -
FSA55_RS15460 43806..44420 + 615 WP_001261742.1 recombinase family protein -
FSA55_RS15465 44585..45409 - 825 WP_001809248.1 hypothetical protein -
FSA55_RS15470 45832..47004 + 1173 WP_000195429.1 IS256-like element IS256 family transposase -
FSA55_RS15475 47379..47636 - 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
FSA55_RS15480 47629..47898 - 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FSA55_RS15485 48029..48208 - 180 WP_001120991.1 hypothetical protein -
FSA55_RS15490 48224..48424 - 201 WP_002347143.1 hypothetical protein -
FSA55_RS15495 48589..49296 - 708 WP_002303117.1 hypothetical protein -
FSA55_RS15500 49289..49726 - 438 WP_002300851.1 hypothetical protein -
FSA55_RS15505 49741..49992 - 252 WP_002296238.1 hypothetical protein -
FSA55_RS15510 49992..50198 - 207 WP_002347218.1 hypothetical protein -
FSA55_RS15515 50635..50895 - 261 WP_002295623.1 hypothetical protein -
FSA55_RS15520 51069..51173 + 105 WP_008274030.1 putative holin-like toxin -
FSA55_RS15525 51314..51799 - 486 WP_002303313.1 single-stranded DNA-binding protein -
FSA55_RS15530 51802..52701 - 900 WP_002303312.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..58508 58508
- flank IS/Tn - - 45832..47004 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288215 WP_000588503.1 NZ_LR135445:c47636-47379 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288215 WP_000388479.1 NZ_LR135445:c47898-47629 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References