Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 16991..17608 | Replicon | plasmid 2 |
| Accession | NZ_LR135444 | ||
| Organism | Enterococcus faecium isolate E7114 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | FSA55_RS14070 | Protein ID | WP_224451579.1 |
| Coordinates | 16991..17143 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A829EWE8 |
| Locus tag | FSA55_RS14075 | Protein ID | WP_002305052.1 |
| Coordinates | 17177..17608 (+) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FSA55_RS14020 | 12832..13317 | + | 486 | Protein_10 | single-stranded DNA-binding protein | - |
| FSA55_RS14025 | 13339..13596 | + | 258 | WP_002295625.1 | hypothetical protein | - |
| FSA55_RS14030 | 13755..13899 | - | 145 | Protein_12 | type I toxin-antitoxin system toxin PepG1 | - |
| FSA55_RS14035 | 14091..14291 | + | 201 | WP_227005125.1 | hypothetical protein | - |
| FSA55_RS14040 | 14739..14945 | + | 207 | WP_002324499.1 | hypothetical protein | - |
| FSA55_RS14045 | 14945..15196 | + | 252 | WP_002287517.1 | hypothetical protein | - |
| FSA55_RS14050 | 15212..15649 | + | 438 | WP_002305049.1 | hypothetical protein | - |
| FSA55_RS14055 | 15642..16337 | + | 696 | WP_002305050.1 | hypothetical protein | - |
| FSA55_RS14060 | 16502..16702 | + | 201 | WP_002324500.1 | hypothetical protein | - |
| FSA55_RS14065 | 16718..16897 | + | 180 | Protein_19 | hypothetical protein | - |
| FSA55_RS14070 | 16991..17143 | + | 153 | WP_224451579.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| FSA55_RS14075 | 17177..17608 | + | 432 | WP_002305052.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| FSA55_RS14080 | 17782..18735 | - | 954 | WP_002325884.1 | IS30 family transposase | - |
| FSA55_RS14085 | 19038..20312 | + | 1275 | WP_002323715.1 | MFS transporter | - |
| FSA55_RS14090 | 20366..21793 | + | 1428 | WP_002361237.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(6')-aph(2'') | - | 1..230681 | 230681 | |
| - | flank | IS/Tn | - | - | 17782..18735 | 953 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5815.65 Da Isoelectric Point: 10.3560
>T288213 WP_224451579.1 NZ_LR135444:16991-17143 [Enterococcus faecium]
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
Download Length: 153 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15811.92 Da Isoelectric Point: 4.1638
>AT288213 WP_002305052.1 NZ_LR135444:17177-17608 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKISVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|